KEGG   Lactococcus lactis subsp. cremoris A76: llh_1995Help
Entry
llh_1995          CDS       T01965                                 

Definition
Recombination protein RecR
Orthology
K06187  
recombination protein RecR
Organism
llr  Lactococcus lactis subsp. cremoris A76
Pathway
Homologous recombination
Brite
KEGG Orthology (KO) [BR:llr00001]
 Genetic Information Processing
  Replication and repair
   03440 Homologous recombination
    llh_1995
DNA repair and recombination proteins [BR:llr03400]
 Prokaryotic Type
  DSBR (double strand breaks repair)
   NHEJ (non-homologous end-joining)
    SHDIR (short-homology-dependent illegitimate recombination)
     RecET pathway
      llh_1995
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
379779..380375
Genome map
AA seq 198 aa AA seqDB search
MYYPEPIARLIESFSKLPGIGQKTATRLAFYTIGMEDQDVNEFAKNLLSAKRDLRFCSIC
GNLTESDPCAICTDPTRDRTTILVVEESKDVLAMEKIREYRGLYHVLHGTISPMNGISPD
EINVKSLITRLMDSEVKEVIIATNATSDGEATAMYLARMIKPAGIKVTRLAHGLAVGSDI
EYADEVTLSKAVENRLEI
NT seq 597 nt NT seq  +upstreamnt  +downstreamnt
atgtattatccagaacctattgctcgcctgattgagtcattttcaaaattacccggaatt
gggcagaaaacggcgacccggctagctttttatacgattggcatggaagatcaagatgtc
aatgaatttgcgaaaaatctcttgtcagcaaaacgagatttacgcttttgctctatttgt
gggaatttaacagaaagtgatccttgtgctatttgtactgatcccacacgtgatagaaca
acgatattggttgtcgaagaatctaaagatgttcttgccatggaaaaaatccgcgaatat
cgtggactctatcatgtcttacatggaacaattagtccaatgaacggaatctctcctgat
gaaattaatgttaaatctttgattacaaggttaatggactcagaagttaaagaagtgatt
attgcgaccaatgcgacatcggatggtgaagcaaccgctatgtatctggctcgaatgatt
aaacctgcgggaattaaagtgacacgactggctcatggattagctgtagggtctgatata
gaatacgctgatgaggttaccttatcaaaagccgtggagaatcggttggaaatttga

DBGET integrated database retrieval system