KEGG   Lactococcus lactis subsp. cremoris A76: llh_3750Help
Entry
llh_3750          CDS       T01965                                 

Definition
recombinase D
Orthology
K03581  
exodeoxyribonuclease V alpha subunit [EC:3.1.11.5]
Organism
llr  Lactococcus lactis subsp. cremoris A76
Pathway
Homologous recombination
Brite
KEGG Orthology (KO) [BR:llr00001]
 Genetic Information Processing
  Replication and repair
   03440 Homologous recombination
    llh_3750
Enzymes [BR:llr01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.11  Exodeoxyribonucleases producing 5'-phosphomonoesters
    3.1.11.5  exodeoxyribonuclease V
     llh_3750
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
703530..706031
Genome map
AA seq 833 aa AA seqDB search
MTDKTYVTGSIEAIFFSNPSNFYKVLLIEIDETNAEYDDFEIVVNGAIGDVVEGDSYTFY
GQLTQHPKYGEQLQVSQYEKAVPTSGAGLVKYFSSDKFPGIGKKTAEKIVETFPENTVDS
ILEAPEKLDGLLTLARKNSFIKRLRENHGMEKMLTKLAEYGLPSKLTFQIYELYKEETIE
KIEENPYQLVEEVKGVGFKTADKIASELGIEADSPNRFRAALMHEVNTHSQATGDTYIEA
KNLLELTIDLLEEARNIEVNPAEVAAEINGLIVDGKVQQEGTKIFENSLFFAEDGIRKSL
TALTNRLGKDFADEKLLTVLEEVEKDLEITYDELQKQAIIGAMNQQFFILTGGPGTGKTT
IINGFIETYARLYQLDLDPDHYNDDVFPILLAAPTGRASRRMNELTGLPAATIHRHLGLG
QDEAEDALGNELSGSLLIVDEFSMVDTWLANKLFQAIPGSMKVLLVGDADQLPSVGPGQI
FADLLKIPEIPSVKLDKIFRQGDDSTITDLAHHIKDGQLPADFTVKKTDRSYFEVSANFV
PQTVEQIASAWQKRGNNPFELQILAPMYKGAAGINAMNILLQNLFNPLNDRLEFVLGDMK
FREGDKVLHLVNDAEANVFNGDLGQIVELIAAKYTDSKQDEIVMDFDGQELTYPRSEWYK
ITLAYAMSIHKSQGSEFSTVIVPMVSSYSRMLERNLLYTAITRAKQSLILLGEERAFAQA
VAREGANRKTFLVERFKDDKPAAENLSVDSLTKKVTDKKEISNKEKNSGSVADLNLENFS
VRKKTAPKVEEISLFDEETESLGNGILTEALILSGNFDPLIGLTEQDFAIFNK
NT seq 2502 nt NT seq  +upstreamnt  +downstreamnt
atgacggataaaacttatgttacaggctcaattgaagctatttttttctctaatccaagc
aatttttataaagttttattaattgagattgatgaaacaaatgctgaatatgatgatttt
gaaattgtggtcaatggggcaattggcgatgtggtcgaaggggattcttatactttttat
gggcaattaacccagcatccaaagtatggggaacaattgcaagtcagtcaatatgaaaag
gctgtaccaacgtctggtgctggtttggtcaagtatttttcatcagataaatttccaggg
attggtaaaaaaacggcagagaaaattgttgaaacttttcctgaaaatacggtagattct
attttagaagcgcctgagaaattggatggtttattaactctagccagaaaaaattcattt
atcaaacgtttgcgtgaaaatcatggtatggaaaaaatgctgaccaagcttgcggagtat
ggcttgccaagtaaactcacttttcaaatttatgagttgtacaaagaggaaacgattgaa
aaaattgaggaaaatccttatcaacttgtggaagaagttaaaggggtgggctttaaaact
gccgataaaattgcgagtgaactagggattgaagcggatagtccaaatcgttttcgagcg
gctttgatgcatgaggtcaatacgcattcgcaagcaacgggtgacacttatattgaagct
aaaaacttgctggaattgacgattgatttacttgaagaagccagaaatattgaggtcaat
ccagctgaagttgctgcggaaataaatggtttaattgttgatggaaaagtacagcaagaa
ggaacgaaaatatttgaaaattccttgttttttgctgaagacggtatccgaaaatcactg
acagccttaactaatcgtttgggaaaagattttgctgacgaaaagttactgacagttttg
gaagaggtagaaaaagatttagagattacttatgatgaacttcagaaacaggccatcatt
ggagcgatgaatcagcaatttttcattttgactgggggaccaggaacggggaaaacaacg
attattaatggtttcattgaaacttatgcccgtctttatcagttagatttagaccctgac
cattataatgatgacgtttttcctattttattggcggcaccgactggtcgcgcttcaaga
cggatgaatgagttgactggacttccagcagcaacaattcatcggcacttaggcttaggg
caagatgaggcagaagatgcgcttggtaatgagttgtcaggttcacttttgattgtcgat
gaattttcaatggttgatacttggctagccaacaaactttttcaagccattcctggttca
atgaaagtccttctcgttggcgatgctgaccaacttccttctgtgggccctggacaaatt
tttgcagatttattaaaaattccagaaattccgtcagtaaaattggataagatttttcgt
cagggagatgattcaacgattaccgatttggctcatcatatcaaagatggacaattacct
gcagattttacggtgaaaaaaactgaccgttcttattttgaagtgagtgctaattttgta
ccacaaacggtggagcaaattgctagtgcttggcaaaaaagaggaaataatccttttgaa
ttacaaattttagcgcccatgtataaaggggccgctgggattaatgcaatgaatattctc
ttgcaaaatctctttaatccgcttaatgaccggcttgaatttgttttgggtgatatgaaa
tttcgtgaaggagataaagtattacatttagtcaatgacgctgaggccaatgtattcaat
ggagatttaggacaaattgttgaattgattgcagcaaaatatactgacagtaaacaagat
gagattgtgatggattttgatggtcaagaattgacctatcccagatctgaatggtataaa
attacgcttgcttatgccatgtctatccataaatcccaaggttcggaattttcaacggtc
atcgtcccgatggtctcttcttattcacggatgttagagcgaaatttactctatacagca
atcacgagggcaaagcaaagcttaattttattgggtgaagagcgtgcctttgctcaggct
gtggcgcgtgaaggagccaatcgaaaaacttttcttgttgagcgttttaaggatgataag
cctgcagctgaaaatctgtcagtagattccttaactaaaaaagttactgacaagaaggaa
atatctaacaaagagaaaaattctggatcagtagcagacttaaacttagaaaatttttct
gtcagaaaaaaaacagcaccaaaagttgaggaaatttcattatttgatgaagaaactgaa
agtttggggaatggaattctaacagaagcgctaattttatctggcaattttgatccctta
attggattgactgagcaagattttgcgatttttaataaatag

DBGET integrated database retrieval system