KEGG   Lactococcus lactis subsp. cremoris A76: llh_3905Help
Entry
llh_3905          CDS       T01965                                 

Definition
Phosphoglycerate mutase like protein
Orthology
K01834  
2,3-bisphosphoglycerate-dependent phosphoglycerate mutase [EC:5.4.2.11]
Organism
llr  Lactococcus lactis subsp. cremoris A76
Pathway
Glycolysis / Gluconeogenesis
Glycine, serine and threonine metabolism
Methane metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Biosynthesis of amino acids
Module
Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
Glycolysis, core module involving three-carbon compounds
Brite
KEGG Orthology (KO) [BR:llr00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    llh_3905
   01230 Biosynthesis of amino acids
    llh_3905
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    llh_3905
  Energy metabolism
   00680 Methane metabolism
    llh_3905
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    llh_3905
Enzymes [BR:llr01000]
 5. Isomerases
  5.4  Intramolecular transferases
   5.4.2  Phosphotransferases (phosphomutases)
    5.4.2.11  phosphoglycerate mutase (2,3-diphosphoglycerate-dependent)
     llh_3905
Exosome [BR:llr04147]
 Exosomal proteins
  Exosomal proteins of bladder cancer cells
   llh_3905
  Exosomal proteins of melanoma cells
   llh_3905
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(734003..734584)
Genome map
AA seq 193 aa AA seqDB search
MTEVYFIRHSLRDNATYDDMDVPLTAEGEKRALILADAFANVSIEQIFSSPFQRSVRTLN
PLAHSKNLEIQLISDLRERNVGHEIADFWPFAKRQWKDFDYKLADGESLREFQNRNISAL
EQILATSKNQKVAIGTHGTSLSTILNFYQPDFQFQDFQSLAGKMPYVIKMDFAENNYLTH
QVIEIDYDNKKSY
NT seq 582 nt NT seq  +upstreamnt  +downstreamnt
atgactgaagtttattttattcgacattctcttagagataatgcaacctatgacgatatg
gatgttcctctgactgccgagggtgaaaaacgcgcactaatcttagctgatgcttttgca
aatgtatcaatcgagcaaattttttccagtccatttcaacgttctgttcgtaccctgaat
cctcttgctcactctaaaaatcttgaaattcaactcatttctgatttgagagaaagaaat
gttggccatgaaatagctgatttttggccttttgcaaagcgacaatggaaagattttgat
tataaacttgctgatggagaatccttacgtgaatttcaaaatcgtaatatttcagccctt
gaacagattttagcaacttctaaaaatcaaaaagttgcaatcggaactcatggtacttct
ctttctaccattttaaatttttatcaaccagactttcagtttcaagattttcaatcttta
gctggcaaaatgccctatgtcatcaaaatggactttgctgaaaataattatctgacccac
caagtcattgaaattgattatgacaataaaaaaagttactga

DBGET integrated database retrieval system