KEGG   Lactococcus lactis subsp. cremoris A76: llh_3905Help
Entry
llh_3905          CDS       T01965                                 

Definition
(GenBank) Phosphoglycerate mutase like protein
  KO
K01834  2,3-bisphosphoglycerate-dependent phosphoglycerate mutase [EC:5.4.2.11]
Organism
llr  Lactococcus lactis subsp. cremoris A76
Pathway
llr00010  Glycolysis / Gluconeogenesis
llr00260  Glycine, serine and threonine metabolism
llr00680  Methane metabolism
llr01100  Metabolic pathways
llr01110  Biosynthesis of secondary metabolites
llr01120  Microbial metabolism in diverse environments
llr01130  Biosynthesis of antibiotics
llr01200  Carbon metabolism
llr01230  Biosynthesis of amino acids
Module
llr_M00001  Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
llr_M00002  Glycolysis, core module involving three-carbon compounds
Brite
KEGG Orthology (KO) [BR:llr00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    llh_3905
  Energy metabolism
   00680 Methane metabolism
    llh_3905
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    llh_3905
Enzymes [BR:llr01000]
 5. Isomerases
  5.4  Intramolecular transferases
   5.4.2  Phosphotransferases (phosphomutases)
    5.4.2.11  phosphoglycerate mutase (2,3-diphosphoglycerate-dependent)
     llh_3905
Membrane trafficking [BR:llr04131]
 Autophagy
  Chaperone mediated autophagy (CMA)
   Selective cargos
    llh_3905
Exosome [BR:llr04147]
 Exosomal proteins
  Exosomal proteins of bladder cancer cells
   llh_3905
  Exosomal proteins of melanoma cells
   llh_3905
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: His_Phos_1
Motif
Other DBs
NCBI-ProteinID: AEU39957
UniProt: G8P7M8
Position
complement(734003..734584)
Genome map
AA seq 193 aa AA seqDB search
MTEVYFIRHSLRDNATYDDMDVPLTAEGEKRALILADAFANVSIEQIFSSPFQRSVRTLN
PLAHSKNLEIQLISDLRERNVGHEIADFWPFAKRQWKDFDYKLADGESLREFQNRNISAL
EQILATSKNQKVAIGTHGTSLSTILNFYQPDFQFQDFQSLAGKMPYVIKMDFAENNYLTH
QVIEIDYDNKKSY
NT seq 582 nt NT seq  +upstreamnt  +downstreamnt
atgactgaagtttattttattcgacattctcttagagataatgcaacctatgacgatatg
gatgttcctctgactgccgagggtgaaaaacgcgcactaatcttagctgatgcttttgca
aatgtatcaatcgagcaaattttttccagtccatttcaacgttctgttcgtaccctgaat
cctcttgctcactctaaaaatcttgaaattcaactcatttctgatttgagagaaagaaat
gttggccatgaaatagctgatttttggccttttgcaaagcgacaatggaaagattttgat
tataaacttgctgatggagaatccttacgtgaatttcaaaatcgtaatatttcagccctt
gaacagattttagcaacttctaaaaatcaaaaagttgcaatcggaactcatggtacttct
ctttctaccattttaaatttttatcaaccagactttcagtttcaagattttcaatcttta
gctggcaaaatgccctatgtcatcaaaatggactttgctgaaaataattatctgacccac
caagtcattgaaattgattatgacaataaaaaaagttactga

DBGET integrated database retrieval system