KEGG   Lactococcus lactis subsp. cremoris A76: llh_4245Help
Entry
llh_4245          CDS       T01965                                 

Definition
Ribokinase (EC:2.7.1.15)
Orthology
K00852  
ribokinase [EC:2.7.1.15]
Organism
llr  Lactococcus lactis subsp. cremoris A76
Pathway
Pentose phosphate pathway
Brite
KEGG Orthology (KO) [BR:llr00001]
 Metabolism
  Carbohydrate metabolism
   00030 Pentose phosphate pathway
    llh_4245
Enzymes [BR:llr01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.15  ribokinase
     llh_4245
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
805978..806898
Genome map
AA seq 306 aa AA seqDB search
MTKVSVVGSISMDLVTSTKRVPQAGETVFGENFAMVPGGKGANQAVAFARLAPHDVNMIG
AVGNDAFGETILKNFKENAVLFDGVGTVPQTTGIAQITLFDDDNRIIIIPGANNEVLPDY
LENFWEKIKDSQLVVLQNEIPHETNLAVAKFCKENAIKVLYNPAPARKTDLEMIEFVDYI
TPNEHECKELFPNEPLEEILAKYANRLIVTLGSEGVICHNGNGVQKIPAIKAKVVDTTGA
GDTFNGAFAFGLTENLSIVDSIQLAVVASHLSIHKFGAQGGMPILAEVEDKLKELNLNFY
KEKKGL
NT seq 921 nt NT seq  +upstreamnt  +downstreamnt
atgacaaaagtaagtgttgtaggaagtatttccatggatttagtgacaagcacaaaaaga
gttccacaagcaggtgaaacagtttttggagaaaattttgcgatggttcctggtggcaag
ggagcaaatcaagccgttgcttttgctagattagctccccatgatgtaaatatgattgga
gcagttggaaatgatgcttttggagaaactattctaaaaaacttcaaagaaaatgctgtt
ctttttgatggtgtaggaacggtaccacaaacgacagggattgcccaaattactttattt
gatgacgataatcgaattatcattattcctggggccaataatgaagtcctccctgattat
ttagagaatttctgggagaaaattaaagacagtcaacttgtggttttacaaaatgaaata
cctcatgaaactaaccttgcagtcgctaaattttgtaaagaaaatgcgataaaagtcctt
tataatccagctccagcaagaaaaacggatttagaaatgattgaatttgtagattacatc
acgcctaatgaacacgaatgtaaggagctttttccgaatgagcctctggaggaaattctt
gctaaatatgcgaatcgcctgattgtcactttaggaagtgaaggagtgatttgccataat
ggtaatggggttcaaaaaattccagcaattaaagctaaagtggtagatacgacgggagca
ggggatacattcaatggagcttttgcttttggactgacagaaaatctatcaatcgttgat
tctatccaattggcagtggttgcttcccatttatctattcataaatttggtgctcaaggt
ggaatgccaattctagcagaagttgaagataaattaaaagagcttaatcttaatttttat
aaggaaaagaaaggactttga

DBGET integrated database retrieval system