KEGG   Lactococcus lactis subsp. cremoris A76: llh_4490Help
Entry
llh_4490          CDS       T01965                                 

Definition
aspartate carbamoyltransferase (EC:2.1.3.2)
Orthology
K00609  
aspartate carbamoyltransferase catalytic subunit [EC:2.1.3.2]
Organism
llr  Lactococcus lactis subsp. cremoris A76
Pathway
Pyrimidine metabolism
Alanine, aspartate and glutamate metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:llr00001]
 Metabolism
  Nucleotide metabolism
   00240 Pyrimidine metabolism
    llh_4490
  Amino acid metabolism
   00250 Alanine, aspartate and glutamate metabolism
    llh_4490
Enzymes [BR:llr01000]
 2. Transferases
  2.1  Transferring one-carbon groups
   2.1.3  Carboxy- and carbamoyltransferases
    2.1.3.2  aspartate carbamoyltransferase
     llh_4490
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
855629..856561
Genome map
AA seq 310 aa AA seqDB search
MSVKNGLVQLENLTSMENLSVDEVMGLIKRSSAFKAGKADFALDEQTFASNLFFENSTRT
HHSFHIAERKLGLDVLEFDAQASSISKGETLYDTVLTLDALGVDICVIRSGVEHYYEELV
NSDNIHCAIVNGGDGSGQHPSQCLLDLMTIYEEFGKFEGLKIAISGDLTHSRVAKSNMMM
LQKLGARLYFTGPAAWYSEEFDDYGHYANLDRILPELDVHMLLRVQHERHDSGESFSKEG
YHTHFGLTQERAKMLKPTAIIMHPAPVNRDVEIADSLVESPQSRIVQQMSNGVYTRMAIL
EAILAGKKAK
NT seq 933 nt NT seq  +upstreamnt  +downstreamnt
atgtcagtaaaaaatggattagttcaactcgaaaaccttacaagcatggaaaacttgagc
gttgatgaagtcatgggacttattaaaagatcctcagctttcaaagcaggaaaagcagac
ttcgctttagatgagcaaactttcgcttcaaatctattctttgaaaattctacaagaaca
catcacagttttcatattgccgaacgtaaactaggacttgatgttcttgaatttgatgca
caagccagttcaatcagtaaaggtgaaacactatacgatacggttttaacgcttgatgca
cttggtgttgacatctgtgtcattcgctctggagtagaacattattacgaagaattagtg
aattcagacaatatccactgtgccattgtcaatggtggagacggttcaggacaacatcca
agtcaatgtttacttgacttgatgactatttatgaagaatttggcaaatttgaaggacta
aaaattgcaatttctggagatttaacacactcacgtgtggctaaatcaaatatgatgatg
ttgcaaaaacttggggctagactttatttcactggtccagcagcatggtacagtgaagaa
tttgacgattacgggcattatgccaacctagaccgtattttaccagaacttgatgttcat
atgctcttacgcgtgcaacatgaacgtcatgacagtggtgaaagtttttcaaaagaaggt
tatcacactcattttggactgacgcaagaacgagcaaaaatgttgaaaccaacagcaatt
attatgcacccagctcctgttaatcgtgatgttgaaattgctgacagcctcgttgaaagt
ccacaaagtcgcattgttcaacaaatgagcaatggtgtttacacacgtatggccattctt
gaagccattcttgctggaaaaaaagcgaagtaa

  All links  
No link information was found.   
DBGET integrated database retrieval system