KEGG   Lactococcus lactis subsp. cremoris A76: llh_4675Help
Entry
llh_4675          CDS       T01965                                 

Definition
(GenBank) 3-ketoacyl-CoA thiolase / Acetyl-CoA acetyltransferase
  KO
K00626  
acetyl-CoA C-acetyltransferase [EC:2.3.1.9]
Organism
llr  Lactococcus lactis subsp. cremoris A76
Pathway
Fatty acid degradation
Synthesis and degradation of ketone bodies
Valine, leucine and isoleucine degradation
Benzoate degradation
Tryptophan metabolism
Pyruvate metabolism
Glyoxylate and dicarboxylate metabolism
Propanoate metabolism
Butanoate metabolism
Terpenoid backbone biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Biosynthesis of antibiotics
Carbon metabolism
Fatty acid metabolism
Two-component system
Brite
KEGG Orthology (KO) [BR:llr00001]
 Metabolism
  Carbohydrate metabolism
   00620 Pyruvate metabolism
    llh_4675
   00630 Glyoxylate and dicarboxylate metabolism
    llh_4675
   00640 Propanoate metabolism
    llh_4675
   00650 Butanoate metabolism
    llh_4675
  Lipid metabolism
   00071 Fatty acid degradation
    llh_4675
   00072 Synthesis and degradation of ketone bodies
    llh_4675
  Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    llh_4675
   00310 Lysine degradation
    llh_4675
   00380 Tryptophan metabolism
    llh_4675
  Metabolism of terpenoids and polyketides
   00900 Terpenoid backbone biosynthesis
    llh_4675
  Xenobiotics biodegradation and metabolism
   00362 Benzoate degradation
    llh_4675
 Environmental Information Processing
  Signal transduction
   02020 Two-component system
    llh_4675
Enzymes [BR:llr01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.9  acetyl-CoA C-acetyltransferase
     llh_4675
Exosome [BR:llr04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   llh_4675
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
UniProt: 
Position
893247..894386
Genome map
AA seq 379 aa AA seqDB search
MKEIVIIDALRTPVGKYDGALAEYSAEKLGTHVVSALLSKNKNIKSDVEQVIFGNVLQAG
NGQNIARQIAINSGLSTSVPASTINEVCGSGMKAVILAKQLLQLGEAEVVIAGGTESMSN
APILKNRKTEEETLSMLSDGLIDAFSGISMGIIGETIAEQFDVSRADQDLFAQNSQEKAV
AASQAGIFNDEIVALGKLSVDETPRPSSSLEKLATLRTAFKENGTVTAGNSSPVNDGASA
LILATKEYAEKHGISYLAELVESAEVGIDPAIMGVSPIDAIQKLVQRSGVQLLEIDLFEI
NEAFAASSIAVNRELGLKDSQVNIYGGAIALGHAIGSSGAKILTTLGYALKREQKRYGIA
SLCIGGGLGLAILLKNPDF
NT seq 1140 nt NT seq  +upstreamnt  +downstreamnt
gtgaaagaaattgtaatcattgacgccttaagaacaccagtcggaaaatatgatggtgct
cttgctgagtattcggcagaaaagcttggaacacacgttgtttcagctttattgtcaaaa
aataaaaatataaaatcagatgttgaacaagttatttttggtaatgttcttcaagctggt
aatggtcaaaatattgcgcgccaaattgcgattaatagtggtttatcaaccagtgttcca
gcttcaaccattaatgaagtttgtggttcagggatgaaggcagtaattctagctaagcaa
cttttacagttgggcgaagcagaagttgttattgctggtggaacggaatcaatgtctaat
gcgcctattcttaaaaatcgtaaaactgaagaagaaacattaagcatgttaagtgacggc
ttaattgatgctttttctggcatttcaatgggaattattggagaaacaattgcggagcag
tttgatgttagtcgtgctgaccaagacctattcgcacaaaattctcaagagaaggcagta
gcagccagtcaagcaggaatttttaatgacgagatcgtagctcttgggaaactttctgtt
gatgaaactcctcgaccttcatctagcctagaaaaattggctacattacggacagccttt
aaggaaaatggaacagttacagctgggaattcttcaccagttaatgacggagcttctgct
ttaattttggccactaaagagtatgctgaaaaacatggaatatcttatttagctgaatta
gttgagagtgcggaagttggtattgaccctgcaattatgggagtatcaccgattgatgca
attcaaaaattagttcaacgctcaggcgttcagcttttagaaatagatctttttgaaatt
aatgaggcctttgctgcatcaagtattgctgttaatcgtgaattgggcttaaaagattct
caagttaatatttatggaggagcgattgctcttggacatgctattgggtcaagtggtgcc
aaaatcctgacaactttgggatatgctttgaaacgagaacaaaagcgttatggaattgct
agtctttgtattggcggtggtctagggcttgctattttattgaaaaatcctgacttttaa

DBGET integrated database retrieval system