KEGG   Lactococcus lactis subsp. cremoris A76: llh_4700Help
Entry
llh_4700          CDS       T01965                                 

Definition
Lysophospholipase, Monoglyceride lipase, putative (EC:3.1.1.5 3.1.1.23)
Orthology
K01048  
lysophospholipase [EC:3.1.1.5]
Organism
llr  Lactococcus lactis subsp. cremoris A76
Pathway
Glycerophospholipid metabolism
Brite
KEGG Orthology (KO) [BR:llr00001]
 Metabolism
  Lipid metabolism
   00564 Glycerophospholipid metabolism
    llh_4700
Enzymes [BR:llr01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.1  Carboxylic-ester hydrolases
    3.1.1.5  lysophospholipase
     llh_4700
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
897540..898385
Genome map
AA seq 281 aa AA seqDB search
MKKQYEIISMKDHYRIRLGIFEPQEKAKGVVQLVHGFGEYTGHYLYLINELVNAGFVCFM
HDQRGHGVLAAAKPKLQGRARNYENFISDALEVRKIIGKRYPKLPVYLFGHSMGGNISLN
VLLRNVENQKLYQKAVIESPWLALTNPPAIPLQKLAQVLGKFNSKIRVRTGLKVDAISHR
SDLVDLVTKDGIYHELLSLRLFSQIMEAGRFAQSQAEQLKIPTLLFCGEEDQICSPLAIR
SFAENAGANLELVEVAEGYHALHLDTKADAFIDKIKAFLLE
NT seq 846 nt NT seq  +upstreamnt  +downstreamnt
atgaagaaacagtatgaaattatttcaatgaaagatcactatcggattcgtcttggaatt
tttgaaccacaagaaaaagcaaaaggcgtggtgcaattagttcatggttttggcgaatat
acgggtcattatttatatttaatcaatgaattagttaatgctggttttgtttgctttatg
cacgaccaaagaggacatggggttctagcagcagctaaacctaaacttcaaggacgagca
agaaattatgaaaactttattagtgatgccttagaagtccgaaaaataattggcaaaaga
tatcccaaattaccagtttatctcttcggacacagtatgggaggaaatatttcactgaat
gttctgctgagaaatgttgaaaatcaaaaactttatcaaaaagcagttattgaatctcct
tggcttgccttgacaaatccaccggctattcccctacaaaagttggctcaagttttaggg
aaatttaattcaaaaattagagttcgtacgggacttaaagttgatgcaatctctcatcgg
agtgacttagttgatttagtgactaaagatggaatatatcatgaactattatctttacgt
ttgttttcacaaattatggaagcaggacgttttgcccaaagtcaggccgagcagttaaag
ataccgaccttattattttgtggagaagaagaccaaatttgttcaccgttagcgattcgt
tcctttgctgaaaatgctggtgctaatttggaattagttgaagttgctgagggctatcat
gcccttcatttagatactaaagcagatgcttttattgacaaaattaaggctttcctgctt
gaataa

DBGET integrated database retrieval system