KEGG   Lactococcus lactis subsp. cremoris A76: llh_5065Help
Entry
llh_5065          CDS       T01965                                 

Definition
Endo-1,4-beta-xylanase C precursor (EC:3.2.1.8)
Orthology
K01181  
endo-1,4-beta-xylanase [EC:3.2.1.8]
Organism
llr  Lactococcus lactis subsp. cremoris A76
Brite
Enzymes [BR:llr01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.8  endo-1,4-beta-xylanase
     llh_5065
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
960922..961746
Genome map
AA seq 274 aa AA seqDB search
MRRGTKKLTLISLIIFALLGLQACKNKKLLDKNEKNPTVQTFQAQSNGPQTLGKSPYDYT
LWYQGGVKHTLSWYGASQRGGAAFKATWSDSDDFLARVGYSWTNAGEDIKNIGNISCQFS
YKKSGEGTAGNYNYIGIYGWIRNETATDPNEKLVEYYIVDDWFGNGGQSEKTPITTATTQ
GNVLGTYQLDGATYQVIKNVREDQPSIDGNQTFTQYFAIRQSPRQKGTISISEHFAQWQK
MGLAIGKVTESSFLVESSGESGWLDCTYLKFTKN
NT seq 825 nt NT seq  +upstreamnt  +downstreamnt
atgagaagaggaactaaaaaactcactctaataagtctaatcatctttgctctattaggc
ttgcaagcttgtaaaaataaaaaattactagataaaaatgaaaaaaatccaacggtgcaa
acttttcaagcacaaagtaatggtccgcaaacattaggcaaaagcccctatgactatact
ttatggtatcaaggaggggtgaaacatacgctttcttggtatggggcatcacaaagaggt
ggtgcagcttttaaggcgacttggtcagattcggatgattttttagcacgtgttggctat
agttggacgaatgctggagaagacattaaaaatattggaaatatttcttgtcagtttagt
tataaaaaatcaggagaaggaacagcaggaaattataactatataggaatttacggctgg
attcgtaatgaaactgcgactgaccctaatgaaaagcttgtcgagtattatattgttgat
gattggtttggtaatggtggacaatctgaaaaaactccgattacaaccgctacaacgcaa
ggtaatgtgcttgggacatatcaacttgacggagcgacttatcaagtcatcaaaaatgtt
agagaagaccagccctctattgacggaaatcaaacttttactcaatattttgcgattaga
caaagtccaagacaaaaaggaaccatttctatttcagagcattttgctcagtggcaaaaa
atgggtctagcaattggaaaggttacagaaagtagttttctagttgaaagcagtggtgaa
tctggttggttggattgtacttatctaaaatttacgaaaaattaa

DBGET integrated database retrieval system