KEGG   Lactococcus lactis subsp. cremoris A76: llh_5490Help
Entry
llh_5490          CDS       T01965                                 

Definition
Indole-3-glycerol phosphate synthase (EC:4.1.1.48)
Orthology
K01609  
indole-3-glycerol phosphate synthase [EC:4.1.1.48]
Organism
llr  Lactococcus lactis subsp. cremoris A76
Pathway
Phenylalanine, tyrosine and tryptophan biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Biosynthesis of amino acids
Module
Tryptophan biosynthesis, chorismate => tryptophan
Brite
KEGG Orthology (KO) [BR:llr00001]
 Metabolism
  Overview
   01230 Biosynthesis of amino acids
    llh_5490
  Amino acid metabolism
   00400 Phenylalanine, tyrosine and tryptophan biosynthesis
    llh_5490
Enzymes [BR:llr01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.1  Carboxy-lyases
    4.1.1.48  indole-3-glycerol-phosphate synthase
     llh_5490
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1025059..1025853
Genome map
AA seq 264 aa AA seqDB search
MNIKEGKFLETILAEKKQEIAQMPDENSKPIRQTYRLYDYLKKHSDQLQVIAEVKKASPS
LGDINLEVDIIAQAKNYEQAGAAMISVLTDPVFFKGNIEYLREISKNVQIPTLNKDFIID
KKQINRALNAGATVILLIVACFENDFEKLEELYNYAISLGLEVLVETHNKAELDRAHQLA
AKIIGVNNRNLKTFEVSLQNSTDLVPYFKEENVYISESGIFGKKEAQKVAENFNGILVGT
ALMQANNLTKSLTDLKIKRKNDEH
NT seq 795 nt NT seq  +upstreamnt  +downstreamnt
atgaacataaaagaaggaaaattcttagaaacaattttagcagaaaaaaaacaagagata
gctcaaatgcctgacgaaaattccaaaccaattcgtcaaacttatagattatatgattac
ctaaaaaaacattctgatcaacttcaagtcattgccgaagtaaaaaaagcttcgccaagt
cttggagatatcaatctcgaagtagacattatcgcccaagccaaaaattatgaacaagct
ggggctgccatgatttccgttctaactgaccctgtattctttaaaggaaacattgaatac
ctccgtgaaatatctaaaaatgttcaaattccaacacttaacaaagattttatcattgat
aaaaagcaaattaatcgagcactcaatgctggtgcaactgttattttattgattgtcgct
tgttttgaaaatgactttgaaaaattagaagaactctacaattatgcaatttcactagga
cttgaagttttagtcgaaacgcataataaggccgaactcgacagagcccatcaacttgct
gctaaaattattggggtcaataatcgtaatctaaagaccttcgaagtgagcttacaaaac
tcaacagatttggttccttattttaaagaagagaatgtttatatttctgaatcaggtatt
ttcggtaaaaaagaggcacaaaaagttgctgaaaatttcaatggaattttggttggaaca
gcactgatgcaagcaaataatctcacaaaatcactgacagatttaaaaatcaaaaggaaa
aatgatgaacattaa

DBGET integrated database retrieval system