KEGG   Lactococcus lactis subsp. cremoris A76: llh_5505Help
Entry
llh_5505          CDS       T01965                                 

Definition
tryptophan synthase subunit beta (EC:4.2.1.20)
Orthology
K01696  
tryptophan synthase beta chain [EC:4.2.1.20]
Organism
llr  Lactococcus lactis subsp. cremoris A76
Pathway
Glycine, serine and threonine metabolism
Phenylalanine, tyrosine and tryptophan biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Biosynthesis of amino acids
Module
Tryptophan biosynthesis, chorismate => tryptophan
Class
Metabolism; Overview; Biosynthesis of amino acids [PATH:llr01230]
Metabolism; Amino acid metabolism; Glycine, serine and threonine metabolism [PATH:llr00260]
Metabolism; Amino acid metabolism; Phenylalanine, tyrosine and tryptophan biosynthesis [PATH:llr00400]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1027508..1028713
Genome map
AA seq 401 aa AA seqDB search
MTYNQPNNQGFYGQFGGQFVPETLMTAVKELEVAYEDSKKDPVFQAELKELLKDYVGREN
PLYFAKRLTEYAGGAKIYLKREDLNHTGAHKINNALGQVLLAKKMGKNKVIAETGAGQHG
VATATAAALFGMECTIYMGEEDVKRQSLNVFRMELLGAKVHSVTDGSRVLKDAVNAALRA
WVAQVEDTHYVMGSVLGPHPFPQIVRDYQAVIGQEARAQFLEKENKLPDALVACVGGGSN
SMGLFYPFVNDESVEMYGVEAAGLGIDTPHHAATITKGRPGVLHGTLMDVLQDENGQILE
AFSISAGLDYPGIGPEHSYFNAVGRAKYVDITDEEALEGFKILSRTEGIIPALESSHAIA
YAVKLSKELGSEKTMIVCLSGRGDKDVVQVKERLEAEKEVK
NT seq 1206 nt NT seq  +upstreamnt  +downstreamnt
atgacctacaatcaacccaataaccaaggattttatggacaatttggtggacaatttgtc
cctgaaactttaatgacagccgtaaaagaattagaagtagcttatgaagacagtaaaaaa
gatccagtttttcaagctgaactaaaagaattgcttaaagattacgttggacgagaaaac
ccactttattttgctaaacgcctgaccgaatatgctggtggtgcaaaaatttatctcaaa
cgcgaagaccttaatcacaccggagctcacaaaataaataacgcccttggccaagtcctc
cttgccaaaaaaatgggaaaaaacaaagtcattgctgagacaggagcgggccaacatgga
gtcgcaacggcaacagcggctgccctctttggcatggaatgtaccatatatatgggtgaa
gaagatgtcaaaagacaatctcttaatgtttttcggatggaattgctcggtgcaaaagtc
cattcagttactgatggttcgcgcgtgcttaaagatgcggtaaatgcagcacttagagca
tgggttgctcaagttgaggatacacattatgtgatgggttcagttctcggacctcaccca
ttcccacaaattgttcgtgattatcaagccgtcattggtcaagaagcacgtgcacaattc
ttagaaaaagaaaataaactaccagatgctttagtggcttgtgttgggggcggttcaaac
tcgatgggacttttctacccattcgttaatgacgaatcagtagagatgtatggtgttgaa
gcagctgggcttgggatagatactccacaccatgcagcaacaattactaaagggcgtcca
ggggttttacacggcacgcttatggatgttcttcaagatgaaaatggacaaatactagaa
gctttcagtatttctgctggtttagactatccaggaattggacctgaacattcctatttc
aatgcggtcggccgtgcaaagtatgttgatattactgatgaagaagcccttgaaggtttc
aaaatcttatctcgcacagaaggaatcataccggcccttgaaagctctcacgcgattgcc
tatgcggtcaaattatctaaagaattaggttcagaaaaaacaatgattgtttgcttatca
ggtcgcggcgataaagatgttgttcaagttaaagaacgtcttgaagcagaaaaagaggtg
aaataa

DBGET integrated database retrieval system