KEGG   Lactococcus lactis subsp. cremoris A76: llh_5510Help
Entry
llh_5510          CDS       T01965                                 

Definition
tryptophan synthase subunit alpha (EC:4.2.1.20)
Orthology
K01695  
tryptophan synthase alpha chain [EC:4.2.1.20]
Organism
llr  Lactococcus lactis subsp. cremoris A76
Pathway
Glycine, serine and threonine metabolism
Phenylalanine, tyrosine and tryptophan biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Biosynthesis of amino acids
Module
Tryptophan biosynthesis, chorismate => tryptophan
Brite
KEGG Orthology (KO) [BR:llr00001]
 Metabolism
  Overview
   01230 Biosynthesis of amino acids
    llh_5510
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    llh_5510
   00400 Phenylalanine, tyrosine and tryptophan biosynthesis
    llh_5510
Enzymes [BR:llr01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.20  tryptophan synthase
     llh_5510
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1028713..1029474
Genome map
AA seq 253 aa AA seqDB search
MKTLQAKLSNKKNNFVPYIMAGDHERGLEGLNETIQLLEQAGSSAIEIGVPFSDPVADGP
VIEQAGLRALAKNVSLSKILDSLKSIETEVPLVIMTYFNPVYQFGIENFVAALENTAVKG
LIIPDLPKEHEAYIKPFITDKDICLVPLVSLTTPISRQKELVVDAEGFIYAVAINGVTGK
ENAYSNQLDHHLETLSKLTDIPVLTGFGISTLTDVERFNKVSAGVIVGSKIVRDLHENKE
SDVIKFIKNAINF
NT seq 762 nt NT seq  +upstreamnt  +downstreamnt
atgaaaactttacaagcaaaattgagcaataaaaaaaataattttgttccctatattatg
gcaggtgaccatgaaagaggattagaagggctcaatgaaaccattcaacttcttgaacaa
gccgggagttctgccattgaaattggtgtacccttctcagaccccgttgctgacggacca
gtaattgaacaagctggcttacgagccttagccaaaaatgtttcactatcaaagattctt
gacagcttaaaatcaattgaaacagaagttcctcttgtcattatgacttattttaatcct
gtctatcagtttggaattgaaaattttgttgcagctcttgagaatacagcagtaaaaggt
ctaattattcctgatttacctaaagaacatgaagcttacattaagccttttattactgat
aaggatatttgcttagtacctttggtgtcattaaccacaccaatttctcgtcagaaagaa
cttgtagtagatgccgaaggattcatttatgccgttgcgatcaatggagtaaccggaaaa
gaaaatgcttatagtaatcaacttgaccatcatttagaaacattgtctaaattaactgat
attcctgttttgacaggatttgggatttcaactttaacagatgttgaacgttttaataag
gtatcagcaggagtaatcgttggttcaaaaatagttagggatttacacgaaaacaaagaa
agtgatgttattaaatttattaaaaacgcaatcaatttttaa

DBGET integrated database retrieval system