KEGG   Lactococcus lactis subsp. cremoris A76: llh_6260Help
Entry
llh_6260          CDS       T01965                                 

Definition
triosephosphate isomerase (EC:5.3.1.1)
Orthology
K01803  
triosephosphate isomerase (TIM) [EC:5.3.1.1]
Organism
llr  Lactococcus lactis subsp. cremoris A76
Pathway
Glycolysis / Gluconeogenesis
Fructose and mannose metabolism
Inositol phosphate metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Biosynthesis of antibiotics
Carbon metabolism
Biosynthesis of amino acids
Module
Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
Glycolysis, core module involving three-carbon compounds
Brite
KEGG Orthology (KO) [BR:llr00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    llh_6260
   01230 Biosynthesis of amino acids
    llh_6260
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    llh_6260
   00051 Fructose and mannose metabolism
    llh_6260
   00562 Inositol phosphate metabolism
    llh_6260
Enzymes [BR:llr01000]
 5. Isomerases
  5.3  Intramolecular oxidoreductases
   5.3.1  Interconverting aldoses and ketoses, and related compounds
    5.3.1.1  triose-phosphate isomerase
     llh_6260
Exosome [BR:llr04147]
 Exosomal proteins
  Exosomal proteins of colorectal cancer cells
   llh_6260
  Exosomal proteins of bladder cancer cells
   llh_6260
  Exosomal proteins of melanoma cells
   llh_6260
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1164887..1165645
Genome map
AA seq 252 aa AA seqDB search
MSRKPIIAGNWKMNKTLSEAQAFVEAVKNNLPSSDNVESVIGAPALFLAPMAYLRQGSEL
KLAAENSYFENAGAFTGENSPAAIVDLGVEYIIIGHSERREYFHETDEDINKKAKAIFAA
GATPILCCGETLETFEAGKTAEWVSGQIEAGLAGLTAEQVSNLVIAYEPIWAIGTGKTAT
NEIADETCGVVRSTVEKLYGKEVSEAVRIQYGGSVKPETIEGLMAKENIDGALVGGASLE
ADSFLALLEMYK
NT seq 759 nt NT seq  +upstreamnt  +downstreamnt
atgtcacgtaaaccaattatcgctggtaactggaaaatgaataaaactttgtcagaagca
caagcttttgttgaagctgttaaaaataacttgccttcatctgataatgttgaatcagtt
atcggtgcacctgctcttttcctcgctcctatggcttaccttcgtcaaggttcagaattg
aaacttgctgctgaaaatagctacttcgaaaatgctggagcattcactggtgaaaacagc
ccagctgcaatcgttgaccttggtgttgaatacatcatcatcggtcacagcgaacgtcgt
gaatatttccacgaaactgacgaagacatcaacaaaaaagcaaaagcaatcttcgctgct
ggagcaactccaatcctttgttgtggtgaaactttggaaacttttgaagctggtaaaaca
gctgaatgggtttcaggtcaaatcgaagctggtcttgcaggattgactgctgaacaagtt
tcaaacttagttatcgcttacgaaccaatctgggcaattggaactggtaaaactgcgaca
aacgaaattgctgacgaaacttgtggtgttgtacgttcaacagttgaaaaactttacgga
aaagaagtttcagaagctgtacgtatccaatacggaggatcagtaaaacctgaaacaatc
gaaggattgatggctaaagaaaacatcgacggtgccctcgttggtggagcttcacttgaa
gctgatagcttccttgcattgcttgaaatgtacaaataa

DBGET integrated database retrieval system