KEGG   Lactococcus lactis subsp. cremoris A76: llh_6385Help
Entry
llh_6385          CDS       T01965                                 

Definition
Dihydrofolate reductase (EC:1.5.1.3)
Orthology
K00287  
dihydrofolate reductase [EC:1.5.1.3]
Organism
llr  Lactococcus lactis subsp. cremoris A76
Pathway
One carbon pool by folate
Folate biosynthesis
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:llr00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00790 Folate biosynthesis
    llh_6385
   00670 One carbon pool by folate
    llh_6385
Enzymes [BR:llr01000]
 1. Oxidoreductases
  1.5  Acting on the CH-NH group of donors
   1.5.1  With NAD+ or NADP+ as acceptor
    1.5.1.3  dihydrofolate reductase
     llh_6385
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1185024..1185530
Genome map
AA seq 168 aa AA seqDB search
MIIGIWAEDEQGLIGEADKMPWSLPAEQKHFKETTMNQVILMGRKTFEGMNKRVLPGRIS
IILTRDETYQSENEKVLIMHSPKEVLDWYYKQDKDLFITGGAEILALFESELELLYRTVV
HEKFQGDTYFPTHFDFGKFKVVSEIFHDKDERNAYTFTIKKYEKVKQP
NT seq 507 nt NT seq  +upstreamnt  +downstreamnt
atgataattggaatatgggcagaagatgagcaaggacttatcggagaagctgacaaaatg
ccttggtctttacctgctgaacaaaaacattttaaagaaacaaccatgaatcaagtgatt
ttgatgggacgaaaaacctttgaaggaatgaacaaacgtgttttgccggggagaataagt
attattttaactcgtgacgaaacttatcaatctgaaaatgaaaaagttctcatcatgcac
agccctaaagaagttctggattggtattataagcaggataaagacttgtttatcacggga
ggcgctgaaatattagccctttttgaatcagaacttgaattgctttatcgaacagttgtt
catgaaaaatttcaaggagatacttatttcccaactcattttgactttgggaaattcaaa
gtggtttcggaaatttttcacgataaagatgagcgaaatgcttatacttttacgattaaa
aaatatgaaaaagtgaaacaaccatga

DBGET integrated database retrieval system