KEGG   Lactococcus lactis subsp. cremoris A76: llh_6725Help
Entry
llh_6725          CDS       T01965                                 

Definition
histidinol dehydrogenase (EC:1.1.1.23)
Orthology
K00013  
histidinol dehydrogenase [EC:1.1.1.23]
Organism
llr  Lactococcus lactis subsp. cremoris A76
Pathway
Histidine metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Biosynthesis of amino acids
Module
Histidine biosynthesis, PRPP => histidine
Class
Metabolism; Overview; Biosynthesis of amino acids [PATH:llr01230]
Metabolism; Amino acid metabolism; Histidine metabolism [PATH:llr00340]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(1246806..1247615)
Genome map
AA seq 269 aa AA seqDB search
MLKQIDYQGSLEEVANKFQGRKAEVSEEVNKSVHEIVKAIRKEGDSAIFSYAKKFDGYNA
DKNNLLVTRKEREEGLEKIDENYFRILRRTKSQIEEFHKHQLGNSWSIYKENGVIMGQIA
RPLERVALYVPGGTAAYPSTVIMNAVPALLAGVKEIIMITPVKADGQVNTNILAAAEVCG
IETIYKVGGAQAVAAVAYGTESIPKVDKIVGPGNIFVATAKKICYGMVDIDMIAGPSEVL
VIADEKANPKYIAADLMAQAEHDKLASAI
NT seq 810 nt NT seq  +upstreamnt  +downstreamnt
atgctcaaacaaattgattatcaaggaagtcttgaagaagttgcaaataaatttcaagga
cgaaaagccgaagtttcagaagaagtaaataaaagtgttcatgaaattgtcaaagctatt
cgtaaagagggtgattctgctatatttagctatgcaaaaaagtttgatggatataatgct
gacaaaaataatttacttgtcacgcgcaaggaacgagaagagggcttagaaaaaattgat
gaaaattactttagaattctgcgtcgtaccaaatcacaaattgaagaattccacaagcat
caattaggaaattcatggagcatttataaagaaaatggggttatcatgggtcaaattgca
cgtcctttagaacgtgtcgccctttacgttccaggtggcacagcagcctatccttcaaca
gttattatgaacgcagtgcccgcacttttagcaggggttaaagaaattattatgattaca
ccagttaaggctgacggacaagtgaatacaaatattttagccgccgccgaagtttgtggg
attgaaacaatctataaagtcggtggcgctcaagctgtggccgccgttgcttacgggaca
gagtctattcctaaagttgataagattgtcggacccggaaatatttttgtagccacggcc
aagaaaatttgttacggtatggttgatattgatatgattgcaggaccgtcagaagttttg
gtcattgctgacgaaaaagcaaatccaaaatatatcgctgctgatttaatggcgcaagcc
gaacatgataaacttgcgtcagcaatttga

DBGET integrated database retrieval system