KEGG   Lactococcus lactis subsp. cremoris A76: llh_7345Help
Entry
llh_7345          CDS       T01965                                 

Definition
UTP--glucose-1-phosphate uridylyltransferase (EC:2.7.7.9)
Orthology
K00963  
UTP--glucose-1-phosphate uridylyltransferase [EC:2.7.7.9]
Organism
llr  Lactococcus lactis subsp. cremoris A76
Pathway
Pentose and glucuronate interconversions
Galactose metabolism
Starch and sucrose metabolism
Amino sugar and nucleotide sugar metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:llr00001]
 Metabolism
  Carbohydrate metabolism
   00040 Pentose and glucuronate interconversions
    llh_7345
   00052 Galactose metabolism
    llh_7345
   00500 Starch and sucrose metabolism
    llh_7345
   00520 Amino sugar and nucleotide sugar metabolism
    llh_7345
Enzymes [BR:llr01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.7  Nucleotidyltransferases
    2.7.7.9  UTP---glucose-1-phosphate uridylyltransferase
     llh_7345
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1371279..1372220
Genome map
AA seq 313 aa AA seqDB search
MKQTTIPNKARKVRKAVIPAAGLGTRFLPATKAIAKEMLPIVDKPTIQFIVEEALKSGIE
DILIVTGKAKRPIEDHFDSNIELEQNLLEKGKTELLKLVEETTDINLHFIRQSHPKGLGH
AVLQAKAFVGNEPFVVMLGDDLMNITGNETPLTKDLINDYEKTHASTIAVMKVPHEDVDK
YGVIDPNGEVSKGLYNVERFVEKPKVEEAPSDLAIIGRYLLTPEIFDVLETQVPGAGNEI
QLTDAIERLNKTQRVFAHEFTGKRYDVGDKLGFVETIIEYGLEHPQIGDNLRNYIIEKAK
ELSKDEPKQNTKK
NT seq 942 nt NT seq  +upstreamnt  +downstreamnt
atgaaacaaactactatacctaacaaagccagaaaagttcgtaaagctgttattcctgct
gctggtcttggaactcgctttttaccagcaactaaagccattgccaaagaaatgttgcca
attgttgataaacctactatccaattcatcgttgaagaagctttgaaatctggaatcgaa
gacattttgattgtaactggtaaagcaaaacgtccaattgaagaccattttgactcaaat
attgagcttgaacaaaatttgcttgaaaaaggaaaaacagaattacttaaacttgtagaa
gaaacaacagatatcaatcttcattttatccgccaatctcatccaaaaggtttgggacac
gctgttcttcaagccaaagcttttgttggcaacgaaccttttgtagttatgcttggtgat
gatttgatgaatatcacaggcaatgaaactcctttgactaaagacttgattaatgattat
gaaaaaactcatgcttcaacaatcgctgtaatgaaagtgcctcatgaagatgttgacaaa
tacggagtaatcgacccaaatggtgaagtttctaaaggtctttacaatgttgaacgtttt
gttgaaaaaccaaaagttgaggaagctccttcagaccttgcaattatcggtcgttacctc
ttgactccagaaatttttgatgttttagaaacacaagtacctggtgctggaaatgaaatt
caattaactgatgcgattgaacgtttgaataaaacacaacgtgtctttgctcatgaattt
actggaaaacgttatgatgttggtgataaacttggttttgtggaaacaataatcgagtat
ggtttagaacacccacaaatcggtgacaatttgagaaattatatcatcgaaaaagctaaa
gaactttctaaagatgaaccaaaacaaaatacaaaaaaataa

DBGET integrated database retrieval system