KEGG   Lactococcus lactis subsp. cremoris A76: llh_7570Help
Entry
llh_7570          CDS       T01965                                 

Definition
glutathione peroxidase (EC:1.11.1.9)
Orthology
K00432  
glutathione peroxidase [EC:1.11.1.9]
Organism
llr  Lactococcus lactis subsp. cremoris A76
Pathway
Glutathione metabolism
Arachidonic acid metabolism
Brite
KEGG Orthology (KO) [BR:llr00001]
 Metabolism
  Lipid metabolism
   00590 Arachidonic acid metabolism
    llh_7570
  Metabolism of other amino acids
   00480 Glutathione metabolism
    llh_7570
Enzymes [BR:llr01000]
 1. Oxidoreductases
  1.11  Acting on a peroxide as acceptor
   1.11.1  Peroxidases
    1.11.1.9  glutathione peroxidase
     llh_7570
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(1412078..1412551)
Genome map
AA seq 157 aa AA seqDB search
MNFYDFSAVKMNGETVSMSDYKGKVVIVVNTASKCGFTPQFEGLEKLYETYKDQGLEILG
FPCNQFANQDAGENTEINEFCQLNYGVTFTMFQKIKVNGKEAHPLYQFLKKEAKGALSGT
IKWNFTKFLIDQDGQVIERFAPKTEPEEMEEEIKKLL
NT seq 474 nt NT seq  +upstreamnt  +downstreamnt
atgaatttttatgattttagtgccgttaaaatgaacggtgaaactgtttcaatgtctgac
tacaaaggaaaagtcgtaatcgtagtcaatacagccagtaaatgtggttttactccacaa
tttgagggacttgaaaaattgtatgaaacatataaggaccaaggattagagattctagga
tttccttgtaatcagtttgctaatcaagatgctggtgaaaatacggaaattaatgaattc
tgtcagttgaattatggcgttacattcaccatgtttcaaaaaattaaagtaaatggaaaa
gaagctcatccactttatcaatttttgaaaaaggaagccaaaggggcgcttagtggaact
attaaatggaatttcacaaagtttttaattgaccaagatggacaagtcattgaacgattt
gcgcccaaaacagagcctgaagaaatggaagaagaaatcaaaaaattactttaa

DBGET integrated database retrieval system