KEGG   Lactococcus lactis subsp. cremoris A76: llh_9485Help
Entry
llh_9485          CDS       T01965                                 

Definition
4-alpha-glucanotransferase (EC:2.4.1.25)
Organism
llr  Lactococcus lactis subsp. cremoris A76
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(1772187..1772534)
Genome map
AA seq 115 aa AA seqDB search
MVANTFSIEPYGEKAYHTGIAVPVFSLRTENSSGVGQFSDLKKLADFTYRSGMDVIQLLT
INDTTTFMDWRDSYPYRAISVFALHPLYLDIHEFWKSYTKEQQEKLLILESEIIL
NT seq 348 nt NT seq  +upstreamnt  +downstreamnt
atggtagctaacacattttcaattgaaccctatggagaaaaagcttaccataccggaata
gcagtaccagttttttctcttagaacggaaaactctagcggagtaggtcagttctcagac
cttaagaaattggctgattttacctatcgctctggcatggatgtcatccaattactaaca
attaatgatacgacgacttttatggattggcgagattcctatccttatcgggcaatttcc
gtttttgctttgcatccactctatttagacattcatgaattttggaaatcttacacaaaa
gagcaacaagaaaaacttttgattttagaatcagaaataattctttag

DBGET integrated database retrieval system