KEGG   Lactococcus lactis subsp. lactis IO-1: lilo_0108Help
Entry
lilo_0108         CDS       T02485                                 

Gene name
glgB
Definition
GlgB protein
Orthology
K00700  
1,4-alpha-glucan branching enzyme [EC:2.4.1.18]
Organism
lls  Lactococcus lactis subsp. lactis IO-1
Pathway
Starch and sucrose metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:lls00001]
 Metabolism
  Carbohydrate metabolism
   00500 Starch and sucrose metabolism
    lilo_0108 (glgB)
Enzymes [BR:lls01000]
 2. Transferases
  2.4  Glycosyltransferases
   2.4.1  Hexosyltransferases
    2.4.1.18  1,4-alpha-glucan branching enzyme
     lilo_0108 (glgB)
Exosome [BR:lls04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   lilo_0108 (glgB)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(112711..114657)
Genome map
AA seq 648 aa AA seqDB search
MPLNILDYDPYLEPFKEDLSLRLFEFARTKKRLLGTDGSLVDFANGYKYFGFQQESKHWT
FREWAPNAKRAWLVGDFNNWENNFELKQAYGGTWEISIPGMLPVGSKVKVKLLLPSGETV
YRVPSYIMFAVPNERHELDGVIVQPKYDWKNKAPQLKEAPLIYEAHIGISTEEYKINSYK
EFTRDVLPRIKKAGYNTIQLMAIMEHPLYASFGYQVSNFFAISSRFGQPEDLMELIDQAH
GMGLRVLLDVVHSHAVKNIEDGLNYFDGTENQYFHEGERGNHPAWKTKLFNYGKDEVIHF
LLSNLKFWLDTYHFDGFRFDGVTSMLYHDHGLGTAFTDYSKYFSLNTDIEAVTYLMLANE
LTHLFNPSATTIAEDMSAMPGMALPISSGGIGFDYRLSMGIPDFWIKQLKEKTDNSLDLL
SLWWELTTRRPGEKNIGYSESHDQALVGDKTIMMWLADEEIYWKMDLNSQSLKIDRAIAL
HKLIRLITFSLAGEGYLNFMGNEFGHPEWLDFPRQENHDDFQHARRQWSLADNKDLRFQY
LLAFDQAMINLERHYKFLESPEPVQQLWIKNSDKLLAYKKGQLLFVFNFHPSYEQELQLQ
FPEKPELIFDSDDQKFGGFGPRSSFGWSKEHLNLILEPRTAMVFRIKE
NT seq 1947 nt NT seq  +upstreamnt  +downstreamnt
atgcctctaaatattttggattatgacccttatttggaacctttcaaagaagatttgtct
ttgcggctttttgaatttgctcgaacaaaaaaacggcttttaggaactgatggttcgctt
gttgattttgctaatggttataagtattttggctttcaacaagaaagtaaacactggact
tttcgcgaatgggcaccaaatgctaaaagagcttggttggttggagatttcaataattgg
gaaaacaattttgagttgaaacaggcctatggtgggacttgggaaatttcaattccgggt
atgctacctgtgggttctaaggtgaaggttaagctgcttttaccttctggtgaaacagtt
tatcgtgttccctcttatattatgtttgctgtccccaatgagcgccatgaattggatgga
gtgattgttcaaccaaaatatgattggaagaataaagcccctcagttaaaagaagctcct
ttgatttatgaagcacatattggtatttcaactgaagaatataaaattaattcttataaa
gaattcacgcgcgatgtcttaccaagaattaaaaaggctggttacaatactattcaactg
atggcaattatggaacatccgctctatgctagttttggttatcaagtttccaatttcttt
gcaatttctagtcgctttggtcagccagaagatttgatggaattgattgatcaagctcat
ggtatgggtttgcgagtgcttttagatgtggttcattcacatgctgtaaaaaatatcgaa
gatggtctcaactattttgatgggacagaaaatcagtattttcatgaaggtgaacgagga
aatcatccagcttggaagacaaaactttttaattatggcaaagatgaagtgattcatttt
ctactttcaaatcttaaattttggttggatacctatcattttgacggttttcgttttgac
ggtgtgacttcaatgctttatcatgatcatggtttagggactgcttttactgattacagc
aaatatttttcgctcaatacagatatcgaagcggtgacttatttgatgttggcaaatgaa
ttaacacatttattcaatccatcagcaacaacaatcgctgaagatatgtcagccatgccg
ggaatggccctacctatttcaagtggtggaattggtttcgattaccgtttatcaatggga
attcctgatttttggattaaacaattgaaagaaaaaacggataatagtcttgacttattg
agtctttggtgggaattaacgacgcgacgtcctggtgaaaaaaatattggttattctgaa
agtcatgaccaagctttagttggtgataaaacgattatgatgtggttagctgatgaagag
atttattggaaaatggaccttaatagtcaatctctaaaaattgaccgtgctatagcgctt
cataaattaattcgcctaattacttttagtttggctggtgagggttatttaaatttcatg
ggtaatgaatttggccaccccgaatggcttgattttccgcgtcaagaaaatcatgatgat
ttccaacatgctagaagacaatggtctttagctgataataaagatttgcgtttccaatat
ttattggcatttgaccaagcgatgattaatctagagcgacattacaagtttttagaaagc
ccagaacctgtccaacaactttggataaaaaattcggataaattactagcttataaaaaa
gggcaacttcttttcgtctttaatttccatcctagttatgaacaagagcttcaactccaa
tttcctgaaaaaccagaacttatcttcgatagtgatgaccaaaaatttggtggttttggt
ccaagaagtagttttggttggtcaaaagagcatttaaatctaatccttgaacctagaact
gctatggttttccgaattaaagaataa

DBGET integrated database retrieval system