KEGG   Lactococcus lactis subsp. lactis IO-1: lilo_0159Help
Entry
lilo_0159         CDS       T02485                                 

Gene name
cpsM
Definition
dTDP-4-keto-6-deoxyglucose-3,5-epimerase
Orthology
K01790  
dTDP-4-dehydrorhamnose 3,5-epimerase [EC:5.1.3.13]
Organism
lls  Lactococcus lactis subsp. lactis IO-1
Pathway
Streptomycin biosynthesis
Polyketide sugar unit biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:lls00001]
 Metabolism
  Metabolism of terpenoids and polyketides
   00523 Polyketide sugar unit biosynthesis
    lilo_0159 (cpsM)
  Biosynthesis of other secondary metabolites
   00521 Streptomycin biosynthesis
    lilo_0159 (cpsM)
Enzymes [BR:lls01000]
 5. Isomerases
  5.1  Racemases and epimerases
   5.1.3  Acting on carbohydrates and derivatives
    5.1.3.13  dTDP-4-dehydrorhamnose 3,5-epimerase
     lilo_0159 (cpsM)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
171876..172487
Genome map
AA seq 203 aa AA seqDB search
MIRKKNMTDNFFEKTLAAREISQIPGMLEFDIPVHGDNRGWFKENFQKEKMVPLGFPESF
FAEEKLQNNVSFSRKNVLRGLHAEPWDKYISVADGGSVLGAWVDLREGENFGHVYQTVID
ASKGIFVPRGVANGFQVLSDTVSYSYLVNDYWALELKPKYAFVNYADPTLGIKWEDVENA
EVSEADKNHPLLKDVKALKADEL
NT seq 612 nt NT seq  +upstreamnt  +downstreamnt
gtgattagaaagaaaaatatgactgataatttttttgaaaaaacattggctgcacgagaa
atcagccaaattcctggaatgttagaatttgatatcccagttcatggtgataatcgtgga
tggtttaaagaaaatttccaaaaagaaaaaatggtgccacttggttttccagagagcttc
tttgccgaagaaaaattacaaaacaatgtaagtttttctcgtaaaaatgttttgcgtggt
ctccacgctgaaccttgggataagtatatttcggtggctgatggcggaagtgttttaggc
gcatgggttgatttacgtgaaggagaaaatttcggtcatgtttatcaaactgtgattgat
gcaagtaaaggaatttttgttccacgtggtgtggctaatggattccaagttttgtctgac
acagtttcttatagctatttagttaatgattactgggcacttgaacttaaaccaaaatac
gcttttgtgaattatgctgacccaactttgggaattaagtgggaagatgttgaaaatgct
gaagtttctgaagctgataaaaatcatccattattaaaagatgtaaaagctttgaaggct
gatgaactctaa

DBGET integrated database retrieval system