KEGG   Lactococcus lactis subsp. lactis IO-1: lilo_0629Help
Entry
lilo_0629         CDS       T02485                                 

Gene name
malQ
Definition
4-alpha-glucanotransferase
Orthology
K00705  
4-alpha-glucanotransferase [EC:2.4.1.25]
Organism
lls  Lactococcus lactis subsp. lactis IO-1
Pathway
Starch and sucrose metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:lls00001]
 Metabolism
  Carbohydrate metabolism
   00500 Starch and sucrose metabolism
    lilo_0629 (malQ)
Enzymes [BR:lls01000]
 2. Transferases
  2.4  Glycosyltransferases
   2.4.1  Hexosyltransferases
    2.4.1.25  4-alpha-glucanotransferase
     lilo_0629 (malQ)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
668615..670618
Genome map
AA seq 667 aa AA seqDB search
MLTNNFSIEPYGEKAYHTGIAVPVFSLRTENSSGVGQFSDLKELADFAHRSGMDIIQLLP
INDTSTFMDWRDSYPYRAISVFALHPIYLDIHIFWDSYTKIQQEKLLIAELELNALEKID
YEKALSLKWEYAEIIYQNSAHKFKASKDYQQFYQQNEDWLKAYAAFSYLRDINQSANFMN
WGKYATYSEDFFEKLTSESNQLDLYIFVQYLLHYQLSEAVDYCHQLGIALKGDIAIGIAH
DSVDAWTHPELFHLDKQAGAPPDIFAVNGQNWGFPTYNWKKMAEDGYAWWKKRLTAMSNY
FDAYRLDHILGFFRIWQMPEDSVRGLLGQFSPAIALSAEEIENNYGIPLRQWGLERFINP
FIKDWVIDEIFGRDNRDWIIQTFLDYIGNGNYTFQNEYNNQKKVEKAQLEDWVREGLYKL
HENIILLKDDENPEKYHPRISLMQTISFREFGDDYKGRLEKLYNDYFYGRNYEFWKEKAY
EKLPVLKDATNMLACGEDLGMVPANVPDVMNHLNILRLIIERMPSDNRFVSPLNEVPYLS
VLTTSSHDTSPLRAWWEENHEEIQRYYNEVMGWYGEAPYYASAEIIQEIVKRHLNSNAMM
VILPIQDWLAMSEQLRKEDAKSEQINIPANPYHYWNYRLHCQLETLIDNQDWTEFLKKFI
KESKRAY
NT seq 2004 nt NT seq  +upstreamnt  +downstreamnt
atgctcaccaataatttttcaattgaaccttacggagaaaaagcttaccatacggggata
gcagtgccagttttttcactaagaactgaaaattctagtggggtagggcaattttcagat
ttgaaagagttagccgattttgcccatcgttctgggatggacattattcaattattacca
attaatgataccagtacttttatggactggcgcgattcatatccttatcgtgccatttct
gtttttgcattgcatccaatttatttagatattcatatcttttgggattcttacacaaaa
attcaacaagaaaagcttctcatcgcggaattagaattaaatgctttagaaaaaatagat
tatgaaaaagcattatccttaaaatgggaatatgctgagattatttatcaaaattcagct
cataaatttaaagcaagcaaagattatcagcaattttatcagcaaaatgaggattggtta
aaggcctatgcggcattttcgtatttaagagatatcaatcaaagtgctaattttatgaat
tggggaaagtatgccacttatagtgaagatttctttgaaaagttaacttcagaaagtaac
caattggatttatatatctttgtgcagtaccttttgcattatcaactttcagaagccgtt
gactattgtcatcaattaggaatcgcactaaaaggagatatcgcaattggaattgctcat
gattccgtagacgcttggactcatccagaactttttcatcttgataaacaagctggcgct
cctcctgatatttttgctgtaaatggacaaaattggggctttccaacctacaattggaaa
aaaatggccgaagatggttatgcatggtggaaaaaacggttaacagccatgtctaattat
tttgatgcttatcggctggaccatattcttggcttctttagaatatggcagatgccagag
gattccgtaagaggtttattgggccaattttcaccagctattgccttgtcagcagaagaa
attgaaaataactatggtattccattaagacaatggggcctcgagcggtttattaatcct
ttcatcaaggattgggtaattgatgaaatttttgggcgagataatcgagattggattatt
caaacatttctggattatataggtaatggaaattatacatttcaaaatgagtataataac
cagaaaaaagtagaaaaagctcaattagaagattgggtgcgagaaggactttataaatta
catgaaaatataatattattaaaagatgatgagaatccagagaaatatcatccacgtatt
tctttaatgcaaacaatcagctttcgagaatttggtgatgactataaaggacggcttgaa
aaactttataatgactatttttatggaaggaattatgaattttggaaagaaaaggcctac
gaaaaattaccagttttaaaagatgctacgaatatgttagcttgtggtgaagatttagga
atggttcccgccaatgtaccagatgtcatgaatcatcttaatattctacgtttgataatt
gagagaatgccttcagataatcgatttgtcagtcctttaaacgaagttccctatttatcg
gtcctaacgacttcaagtcacgatacaagtccactaagagcttggtgggaagaaaatcat
gaggaaattcaacgttactacaatgaagtcatgggttggtatggcgaagctccttattat
gcaagtgcagaaattatccaagagatagttaaaagacatttaaactcaaatgcgatgatg
gttatcttacctattcaagattggttagcaatgagtgaacaattgcgaaaagaagatgca
aaatccgaacaaattaatattccagcaaatccataccattactggaattaccgattgcat
tgtcaacttgaaacattgattgataatcaggattggactgaatttttaaagaaatttatc
aaagaaagtaaaagagcctattaa

DBGET integrated database retrieval system