KEGG   Lactococcus lactis subsp. lactis IO-1: lilo_1429Help
Entry
lilo_1429         CDS       T02485                                 

Gene name
xylA
Definition
xylose isomerase
Orthology
K01805  
xylose isomerase [EC:5.3.1.5]
Organism
lls  Lactococcus lactis subsp. lactis IO-1
Pathway
Pentose and glucuronate interconversions
Fructose and mannose metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:lls00001]
 Metabolism
  Carbohydrate metabolism
   00040 Pentose and glucuronate interconversions
    lilo_1429 (xylA)
   00051 Fructose and mannose metabolism
    lilo_1429 (xylA)
Enzymes [BR:lls01000]
 5. Isomerases
  5.3  Intramolecular oxidoreductases
   5.3.1  Interconverting aldoses and ketoses, and related compounds
    5.3.1.5  xylose isomerase
     lilo_1429 (xylA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(1569415..1570734)
Genome map
AA seq 439 aa AA seqDB search
MAYFNDIAPIKYEGTKTKNMFAFRHYNPEEVVAGKTMEEQLHFALAFWHTITMDGSDPFG
GATMERPWDLEGGSELDRAHRRVDAFFEIAEKLGVKYYCFHDIDIAPTGNSLKEFYANLD
EITDHLLEKQKATGIKLLWNTANMFSNPRYMNGVSTSNRAEVFAYGAAQVKKGLELSKKL
GGENYVFWGGREGYESLLNTDMGLEMDHMAKFFHLAIDYAKSINHLPIFLIEPKPKEPMT
HQYDFDSATALAFLQKYDLDKYFKLNLETNHAWLAGHTFEHELNTARTFNALGSIDANQG
NYLLGWDTDEFPTLVIDITLAMHQILLNGGLGKGGINFDAKVRRTSFKAEDLILAHIAGM
DTYARALKGAAAIIEDKFLSDIVDERYSSYKNTEVGQSIENGTATFKSLAAFALEHGDDI
ELDSNHLEYIKSVLNDYLV
NT seq 1320 nt NT seq  +upstreamnt  +downstreamnt
atggcttactttaacgacatcgcacctatcaaatacgaaggtacaaaaactaaaaatatg
tttgcctttcgccattataatccagaagaagtagttgctggtaaaacaatggaagaacaa
cttcattttgcccttgcattttggcatacaattacaatggatgggtcagatccctttggg
ggagcaacaatggaacgcccttgggatttggaaggtggttctgaacttgaccgtgctcac
cgtcgagtagatgctttctttgaaattgctgaaaaattaggtgttaaatattattgtttc
catgatattgatattgcacctactggaaattctttgaaagaattttatgctaatttggac
gaaattactgaccaccttcttgaaaaacaaaaagcaacagggattaaattactttggaat
acagcaaacatgttttcaaatccccgctatatgaatggtgtttcaacttctaatcgtgct
gaagtctttgcttatggtgctgcacaagttaaaaaaggtcttgaactttctaaaaaactc
ggtggtgaaaattacgtcttctggggtggtcgtgaaggttatgaatcacttttgaataca
gatatgggtcttgaaatggatcatatggcaaaattcttccatttggcaattgattatgca
aaatcaatcaaccacttgcccattttcttgattgaaccaaaaccaaaagaaccaatgact
caccaatatgattttgactcagcaacagctcttgctttcttgcaaaaatatgatttggac
aaatatttcaaactcaatcttgaaacaaatcatgcttggttggctggacacacttttgaa
cacgaattaaatactgctcgtactttcaatgctttgggttctattgatgccaatcaagga
aattacttgcttggttgggatacagatgaattcccaacacttgttattgatatcacactt
gcgatgcaccaaattcttttgaacggtggacttggcaaaggtggaattaactttgatgcg
aaagtacgtcgtacaagtttcaaagcagaagatttaattcttgctcatattgcagggatg
gatacttatgcgcgtgctttgaaaggtgcagcagcaatcattgaagataaattcttgtct
gatattgttgacgaacgttatagttcatacaaaaatacagaagttggacaatctattgaa
aatggaacagcaacttttaaaagtcttgccgcatttgcacttgaacatggtgacgatatt
gaacttgattctaatcacttggaatacatcaaatcagtattgaatgactatcttgtttaa

DBGET integrated database retrieval system