KEGG   Lactococcus lactis subsp. lactis IO-1: lilo_2129Help
Entry
lilo_2129         CDS       T02485                                 

Gene name
adhE
Definition
(GenBank) alcohol dehydrogenase / acetaldehyde dehydrogenase
  KO
K04072  acetaldehyde dehydrogenase / alcohol dehydrogenase [EC:1.2.1.10 1.1.1.1]
Organism
lls  Lactococcus lactis subsp. lactis IO-1
Pathway
lls00010  Glycolysis / Gluconeogenesis
lls00071  Fatty acid degradation
lls00350  Tyrosine metabolism
lls00620  Pyruvate metabolism
lls00625  Chloroalkane and chloroalkene degradation
lls00626  Naphthalene degradation
lls00650  Butanoate metabolism
lls01100  Metabolic pathways
lls01110  Biosynthesis of secondary metabolites
lls01120  Microbial metabolism in diverse environments
lls01130  Biosynthesis of antibiotics
lls01220  Degradation of aromatic compounds
Brite
KEGG Orthology (KO) [BR:lls00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    lilo_2129 (adhE)
   00620 Pyruvate metabolism
    lilo_2129 (adhE)
   00650 Butanoate metabolism
    lilo_2129 (adhE)
  Lipid metabolism
   00071 Fatty acid degradation
    lilo_2129 (adhE)
  Amino acid metabolism
   00350 Tyrosine metabolism
    lilo_2129 (adhE)
  Xenobiotics biodegradation and metabolism
   00625 Chloroalkane and chloroalkene degradation
    lilo_2129 (adhE)
   00626 Naphthalene degradation
    lilo_2129 (adhE)
Enzymes [BR:lls01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.1  alcohol dehydrogenase
     lilo_2129 (adhE)
  1.2  Acting on the aldehyde or oxo group of donors
   1.2.1  With NAD+ or NADP+ as acceptor
    1.2.1.10  acetaldehyde dehydrogenase (acetylating)
     lilo_2129 (adhE)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Fe-ADH Aldedh Fe-ADH_2 Ring_hydroxyl_A
Motif
Other DBs
NCBI-ProteinID: BAL52125
UniProt: H5T211
Position
2293346..2296057
Genome map
AA seq 903 aa AA seqDB search
MATKKAAPAAKKVLSAEEKAAKFQEAVAYTDKLVKKAQAAVLKFEGYTQTQVDTIVAAMA
LAASKHSLELAHEAVNETGRGVVEDKDTKNHFASESVYNAIKNDKTVGVISENKVAGSVE
IASPLGVLAGIVPTTNPTSTAIFKSLLTAKTRNAIVFAFHPQAQKCSSHAAKIVYDAAIE
AGAPEDFIQWIEVPSLDMTTALIQNRGLATILATGGPGMVNAALKSGNPSLGVGAGNGAV
YVDATANIERAVEDLLLSKRFDNGMICATENSAVIDASVYDEFIAKMQEQGAYMVPKKDY
KAIESFVFVERAGEGFGVTGPVAGRSGQWIAEQAGVKVPKDKDVLLFELDKKNIGEALSS
EKLSPLLSIYKAETREEGIEIVRSLLAYQGAGHNAAIQIGAMDDPFVKEYGEKVEASRIL
VNQPDSIGGVGDIYTDAMRPSLTLGTGSWGKNSLSHNLSTYDLLNVKTVAKRRNRPQWVR
LPKEIYYEKNAISYLQELPHVHKAFIVADPGMVKFGFVDKVLEQLAIRPTQVETSIYGSV
QPDPTLSEAIAIARQMKQFEPDTVICLGGGSALDAGKIGRLIYEYDARGEADLSDDASLK
ELFQELAQKFVDIRKRIIKFYHPHKAQMVAIPTTSGTGSEVTPFAVITDDETHVKYPLAD
YQLTPQVAIVDPEFVMTVPKRTVSWSGIDAMSHALESYVSVMSSDYTKPISLQAIKLIFE
NLTESYHYDPAHPTKEGQKARENMHNAATLAGMAFANAFLGINHSLAHKIGGEFGLPHGL
AIAIAMPHVIKFNAVTGNVKRTPYPRYETYRAQEDYAEISRFMGFAGKDDSDEKAVQALV
AELKKLTDSIDINITLSGNGVDKAHLERELDKLADLVYDDQCTPANPRQPRIDEIKQLLL
DQY
NT seq 2712 nt NT seq  +upstreamnt  +downstreamnt
atggcaactaaaaaagccgctccagctgcaaagaaagttttaagcgctgaagaaaaagcc
gcaaaattccaagaagctgttgcttatactgacaaattagtcaaaaaagcacaagctgct
gttcttaaatttgaaggatatacacaaactcaagtcgatactattgtcgctgcaatggct
cttgcagcaagcaaacattctctagaactcgctcatgaagccgttaacgaaactggtcgt
ggtgttgtcgaagacaaagatacaaaaaaccactttgcttctgaatctgtttataacgca
attaaaaatgacaaaactgttggtgtcatttctgaaaacaaggttgctggatctgttgaa
atcgcaagccctctcggtgtacttgctggtatcgttccaacaactaatccaacatcaaca
gcaatctttaaatctttattgactgcaaaaacacgtaatgctattgttttcgctttccac
cctcaagctcaaaaatgttcaagccatgcagcaaaaattgtttacgatgctgcaattgaa
gctggtgcaccggaagactttattcaatggattgaagtaccaagccttgacatgactacc
gccttgattcaaaaccgtggacttgcaacaatccttgcaactggtggcccaggaatggta
aacgccgcactcaaatctggtaacccttcactcggtgttggagctggtaatggtgctgtt
tatgtcgatgctactgcaaatatcgaacgtgctgttgaagatcttttgctttcaaaacgt
tttgataatgggatgatttgtgccactgaaaattcagctgttattgatgcttcagtttat
gatgaatttattgctaaaatgcaagaacaaggcgcttatatggttcctaaaaaagactac
aaagctattgaaagtttcgtttttgttgaacgtgctggtgaaggttttggagtaactggt
cctgttgccggtcgttctggtcaatggattgctgaacaagctggcgtcaaagttcctaaa
gataaagatgtccttctttttgaacttgataagaaaaatattggtgaagcactttcttct
gaaaaactttctcctttgctttcaatctacaaagctgaaacacgtgaagaaggaattgag
attgtacgtagcttacttgcttatcaaggtgctggacataatgctgcaattcaaatcggt
gcaatggatgatccattcgttaaagaatatggcgaaaaagttgaagcttctcgcatcctc
gttaaccaaccagattctattggtggggtcggagatatctatactgatgcaatgcgtcca
tcacttacacttggaactggttcatgggggaaaaattcactttcacacaatttgagtaca
tacgatctattgaatgttaaaacagtggctaaacgtcgtaatcgcccacaatgggttcgt
ttgccaaaagaaatttactacgaaaaaaatgcaatttcttacttacaagaattgccacac
gtccacaaagctttcatcgttgctgaccctggtatggttaaatttggtttcgttgataaa
gttttggaacaacttgctatccgcccaactcaagttgaaacaagcatttatggctctgtt
caacctgacccaactttgagcgaagcaattgcaatcgctcgtcaaatgaaacaatttgaa
cctgatactgtcatctgtcttggtggtggttctgctctcgatgctggtaagattggtcgt
ttgatttatgaatatgatgctcgtggtgaagctgacctttctgatgatgcaagtttgaaa
gaacttttccaagaattagctcaaaaatttgtcgatattcgtaaacgtattattaaattc
taccatccacataaagcacaaatggttgcaattcctactacttctggtactggttctgaa
gtgactccatttgcagttatcactgacgatgaaactcatgttaagtacccacttgctgac
tatcaattaacaccacaagttgccattgttgaccctgagtttgttatgactgtaccaaaa
cgtactgtttcttggtctggtattgatgcgatgtcacacgcgcttgaatcttacgtttct
gttatgtcttctgactatacaaaaccaatttcacttcaagctatcaaacttatctttgaa
aacttgactgagtcttatcattatgacccagcgcatccaactaaagaaggacaaaaagcc
cgcgaaaacatgcacaatgctgcaacactcgctggtatggccttcgctaatgctttcctt
ggaattaaccactcacttgctcataaaattggtggtgaatttggacttcctcatggtctt
gccattgccatcgctatgccacatgtcattaaatttaacgctgtaacaggaaacgttaaa
cgtaccccttacccacgttatgaaacatatcgtgctcaagaggactacgctgaaatttca
cgctttatgggatttgctggtaaagatgattcagatgaaaaagctgtgcaagctctggtt
gctgaacttaaaaaattgactgatagcattgatattaacatcaccctttcaggaaatggt
gtcgataaagctcaccttgaacgtgaacttgataaattggctgaccttgtttatgatgat
caatgtactcctgctaatcctcgtcaaccaagaattgatgagattaaacaactcttgtta
gaccaatattaa

DBGET integrated database retrieval system