KEGG   Lactococcus lactis subsp. lactis CV56: CVCAS_0127Help
Entry
CVCAS_0127        CDS       T01964                                 

Gene name
glgB
Definition
(GenBank) 1,4-alpha-glucan branching enzyme
  KO
K00700  1,4-alpha-glucan branching enzyme [EC:2.4.1.18]
Organism
llt  Lactococcus lactis subsp. lactis CV56
Pathway
llt00500  Starch and sucrose metabolism
llt01100  Metabolic pathways
llt01110  Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:llt00001]
 Metabolism
  Carbohydrate metabolism
   00500 Starch and sucrose metabolism
    CVCAS_0127 (glgB)
Enzymes [BR:llt01000]
 2. Transferases
  2.4  Glycosyltransferases
   2.4.1  Hexosyltransferases
    2.4.1.18  1,4-alpha-glucan branching enzyme
     CVCAS_0127 (glgB)
Exosome [BR:llt04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   CVCAS_0127 (glgB)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: CBM_48 Alpha-amylase Alpha-amylase_C
Motif
Other DBs
NCBI-ProteinID: ADZ62795
Position
complement(127449..129395)
Genome map
AA seq 648 aa AA seqDB search
MPLNILDYDPYLEPFKEDLSLRLFEFARTKKRLLGTDGSLVDFANGYKYFGFQQESKHWT
FREWAPNAKRAWLVGDFNNWENNFELKQAYGGTWEISIPGMLPVGSKVKVKLLLPSGETV
YRVPSYIMFAIPNERHELDGVIVQPKYDWKNKAPQLKEAPLIYEAHIGISTEEYKINSYK
EFTRDVLPRIKKAGYNTIQLMAIMEHPLYASFGYQVSNFFAISSRLGQPEDLMELIDQAH
GIGLRVLLDVVHSHAVKNIEDGLNYFDGTENQYFHEGERGNHPAWKTKLFNYGKDEVIHF
LLSNLKFWLDTYHFDGFRFDGVTSMLYHDHGLGTVFTDYSKYFSLNTDIEAVTYLMLANE
LTHLFNPSATTIAEDMSAMPGMALPISSGGIGFDYRLSMGIPDFWIKQLKEKTDNSLDLL
SLWWELTTRRPGEKNIGYSESHDQALVGDKTIMMWLADEEIYWKMDLNNQSLKIDRAIAL
HKLIRLITFSLAGEGYLNFMGNEFGHPEWLDFPRQENHDNFQHARRQWSLADNKDLRFQY
LLAFDQAMINLERHYKFLESPEPVQQLWIKNSDKLLAYQKGQLLFVFNFHPSYEQELQLQ
FPEKPELIFDSDDQKFGGFGPRSSFGWSKGHLNLILEPRTAMVFRIKE
NT seq 1947 nt NT seq  +upstreamnt  +downstreamnt
atgcctctaaatattttggattacgacccttatttggaacctttcaaagaagatttgtct
ttgcggctttttgaatttgctcgaacaaaaaaacggcttttaggaactgatggttcgctt
gttgattttgctaatggttataagtattttggctttcaacaagaaagtaaacactggact
tttcgcgaatgggcaccaaatgctaaaagagcttggttggttggagatttcaataattgg
gaaaacaattttgagttgaaacaggcctatggtgggacttgggaaatttcaattccgggt
atgctacctgtgggttctaaggtgaaggttaagctgcttttaccgtctggtgaaacagtt
tatcgtgttccctcttatattatgtttgctatccccaatgagcgccatgaattggatgga
gtgattgttcaaccaaaatatgattggaagaataaagcccctcagttaaaagaagctcct
ttgatttatgaagcacatattggtatttcaactgaagaatataaaattaattcttataaa
gaattcacgcgcgatgtcttaccaagaattaaaaaggctggttacaatactattcaactg
atggcaattatggaacatccgctctatgctagttttggttatcaagtttccaatttcttt
gcaatttctagtcgccttggtcagccagaagatttgatggaattgattgatcaagctcat
ggtataggtttgcgagtgcttttagatgtggttcattcacatgctgtaaaaaatatcgaa
gatggtctcaactattttgatgggacagaaaatcagtattttcatgaaggtgaacgagga
aatcatccagcttggaagacaaaactttttaattatggcaaagatgaagtgattcatttt
ctactttcaaatcttaaattttggttggatacctatcattttgacggttttcgttttgac
ggtgtgacttcaatgctttatcatgatcatggtttagggactgtatttactgattacagc
aaatatttttcgctcaatacagatatcgaagcggtgacttatttgatgttggcaaatgaa
ttaacacatttattcaatccatcagcaacaacaatcgctgaagatatgtcagccatgccg
ggaatggccctacctatttcaagtggtggaattggtttcgattaccgtttatcaatggga
attcctgatttttggattaaacaattgaaagaaaaaacggataatagtcttgacttattg
agtctttggtgggaattaacgacgcgacgtcccggtgaaaaaaatattggttattctgaa
agtcatgaccaagctttagttggtgataaaacgattatgatgtggttagctgatgaagag
atttattggaaaatggaccttaataatcaatctctaaaaattgaccgtgccatagcactt
cataaattaattcgcctaattacttttagtttggctggtgagggttatttaaatttcatg
ggtaatgaatttggccaccccgaatggcttgattttccgcgtcaagaaaatcatgataat
ttccaacatgctagaagacaatggtctttagctgataataaagatttgcgtttccaatat
ttattggcatttgaccaagcgatgattaatctagagcgacattacaagtttttagaaagc
ccagaacctgtccaacaactttggataaaaaattcggataaattactagcttaccaaaaa
gggcaacttcttttcgtctttaatttccatcctagttatgaacaagagcttcaactccaa
tttcctgaaaaaccagaacttatcttcgatagtgatgaccaaaaatttggtggttttggt
ccaagaagtagttttggttggtcaaaagggcatttaaatctaatccttgaacctagaact
gccatggttttccgaattaaagaataa

DBGET integrated database retrieval system