KEGG   Lactococcus lactis subsp. lactis CV56: CVCAS_0321Help
Entry
CVCAS_0321        CDS       T01964                                 

Gene name
pmg
Definition
(RefSeq) phosphoglycerate mutase (EC:5.4.2.1)
  KO
K01834  
2,3-bisphosphoglycerate-dependent phosphoglycerate mutase [EC:5.4.2.11]
Organism
llt  Lactococcus lactis subsp. lactis CV56
Pathway
Glycolysis / Gluconeogenesis
Glycine, serine and threonine metabolism
Methane metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Biosynthesis of antibiotics
Carbon metabolism
Biosynthesis of amino acids
Module
Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
Glycolysis, core module involving three-carbon compounds
Brite
KEGG Orthology (KO) [BR:llt00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    CVCAS_0321 (pmg)
   01230 Biosynthesis of amino acids
    CVCAS_0321 (pmg)
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    CVCAS_0321 (pmg)
  Energy metabolism
   00680 Methane metabolism
    CVCAS_0321 (pmg)
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    CVCAS_0321 (pmg)
Enzymes [BR:llt01000]
 5. Isomerases
  5.4  Intramolecular transferases
   5.4.2  Phosphotransferases (phosphomutases)
    5.4.2.11  phosphoglycerate mutase (2,3-diphosphoglycerate-dependent)
     CVCAS_0321 (pmg)
Exosome [BR:llt04147]
 Exosomal proteins
  Exosomal proteins of bladder cancer cells
   CVCAS_0321 (pmg)
  Exosomal proteins of melanoma cells
   CVCAS_0321 (pmg)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
322323..323024
Genome map
AA seq 233 aa AA seqDB search
MPKLVFARHGESEWNLANLFTGWADVDLSENGTKQAIEAGKLIKEAGIEFDIAYTSVLKR
AIKTTNLALEYSDQLWVPVVKSWRLNERHYGGLTGLNKADAAAKHGDEQVHIWRRSYDVL
PPAMDHDDKYTAHGDRRYAGLEDSLIPDAENLKVTLERALPFWEDQIAPALKEGKNVFVG
AHGNSIRALVKQIKKLSDDEIMDVEIPNFPPLVFEFDDNLNVQNEYYLAPKKA
NT seq 702 nt NT seq  +upstreamnt  +downstreamnt
atgccaaaattagtatttgcacgtcacggtgaatctgaatggaatcttgctaaccttttc
acaggttgggctgacgttgacctttctgaaaacggaactaaacaagcgattgaagctggt
aaattgattaaagaagctggaatcgaatttgatattgcttacacttcagtattgaaacgt
gctatcaaaacaactaaccttgctcttgaatattcagaccaactttgggtaccagttgtt
aaatcatggcgcttgaacgaacgtcactacggtggtttgacaggtttgaacaaagctgac
gctgctgcaaaacatggtgatgaacaagttcacatctggcgtcgttcatatgatgtattg
ccaccagcaatggatcatgatgataaatatacagctcacggagaccgtcgttacgctggt
cttgaagattcattgattcctgatgctgaaaacctcaaagttactttggaacgtgctctt
ccattctgggaagaccaaatcgctccagctttgaaagaaggaaaaaatgtcttcgttggt
gctcacggtaactcaatccgtgcactcgttaaacaaatcaaaaaactttctgatgacgaa
attatggatgttgaaatccctaacttcccaccacttgttttcgaatttgatgacaacttg
aacgttcaaaacgaatactacttggctcctaaaaaagcataa

DBGET integrated database retrieval system