KEGG   Lactococcus lactis subsp. lactis CV56: CVCAS_0325Help
Entry
CVCAS_0325        CDS       T01964                                 

Gene name
recR
Definition
recombination protein RecR
Orthology
K06187  
recombination protein RecR
Organism
llt  Lactococcus lactis subsp. lactis CV56
Pathway
Homologous recombination
Class
Genetic Information Processing; Replication and repair; Homologous recombination [PATH:llt03440]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
327827..328423
Genome map
AA seq 198 aa AA seqDB search
MYYPEPIARLIESFSKLPGIGQKTATRLAFYTIGMEDQDVNEFAKNLLSAKRDLSFCSIC
GNLTESDPCAICTDPTRDRTTILVVEESKDVLAMEKIREYRGLYHVLHGTISPMNGISPD
EINVKTLITRLMDSEVKEVIIATNATSDGEATAMYLARMIKPAGIKVTRLARGLAVGSDI
EYADEITLSKAVENRLEI
NT seq 597 nt NT seq  +upstreamnt  +downstreamnt
atgtattatcctgaacctattgctcgcctgattgagtcgttttcaaaattaccagggatt
ggtcaaaaaacagcgactcgattggctttttatacgattggcatggaagatcaagatgtc
aatgaatttgcaaaaaatcttctttcagcaaaacgggatttgagtttttgctcgatttgt
gggaatttaacagaaagtgatccttgcgccatttgtaccgacccaacgcgtgatcgaaca
actatattggtcgttgaagaatctaaagatgttcttgctatggaaaaaattcgggaatat
cgaggactttatcatgttttgcatggtacgattagtccaatgaatgggatttctcctgat
gaaattaatgttaaaacattgattacaagattaatggattcagaggttaaagaagtgatc
atcgcaactaatgccacttctgacggagaagcaaccgccatgtatctggctcgaatgatt
aagcctgcaggaattaaagtgactcgcttggctcgtggattagctgtaggctctgatata
gaatacgcagatgaaattactttatcaaaagcggtagagaatcggttggaaatttga

DBGET integrated database retrieval system