KEGG   Lactococcus lactis subsp. lactis CV56: CVCAS_0340Help
Entry
CVCAS_0340        CDS       T01964                                 

Gene name
mutM
Definition
formamidopyrimidine-DNA glycosylase (EC:3.2.2.23 4.2.99.18)
Orthology
K10563  
formamidopyrimidine-DNA glycosylase [EC:3.2.2.23 4.2.99.18]
Organism
llt  Lactococcus lactis subsp. lactis CV56
Pathway
Base excision repair
Class
Genetic Information Processing; Replication and repair; Base excision repair [PATH:llt03410]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
345655..346473
Genome map
AA seq 272 aa AA seqDB search
MPELPEVETVRRDLEKRIVGQKIVSIEATYPRMVLTGFEQLKKELTGKTIHGISRRGKYL
IFEIGEKDRLISHLRMEGKYRLASLNVPMEKHDHLALKFTDEQLIYADVRKFGTWELIST
DQVLPYFLKKNIGPEPTYETFDEQIFREKLQKSTKKIKPFLLEQTLVAGLGNIYVDEVLW
LAKIHPEKVANQLTESSIHLLHDSIIEILQKAIKLGGSSIRTYSALGSTGKMQDELRVYG
KTGEKCVRCGNEIQKIKVAGRGTHFCPFCQQK
NT seq 819 nt NT seq  +upstreamnt  +downstreamnt
atgccagagttaccagaagttgaaacagtgagaagagatcttgaaaaaagaattgttgga
caaaaaattgtatctatagaagccacttatccaagaatggttttaactggttttgagcaa
ttgaaaaaagaattgacaggaaaaaccattcatggcatttcacgtcgcggaaaatattta
atttttgaaattggcgagaaagatcgtttgatttctcatctgcggatggaaggaaaatat
cgacttgcaagtctcaatgttccaatggaaaaacatgaccatttagcccttaaatttact
gacgaacaattaatttatgctgacgtaagaaaatttgggacttgggaactgatttctact
gaccaagtccttccatattttttgaagaaaaacattggtccggagccaacttatgaaact
tttgatgaacagattttccgagaaaaattgcagaaatcgacaaagaaaattaaacctttt
ctacttgaacaaacattagtggctggacttggaaatatttacgttgatgaagtgctctgg
ctagcaaagattcatccagaaaaagtggcaaatcaactgacagaaagttctattcatctt
ttacatgattctatcattgaaattttgcaaaaagcaattaaattaggcggctcaagcatc
agaacttatagtgccttaggttcaacaggaaaaatgcaggacgaattacgagtgtatgga
aaaacaggggaaaaatgtgtgcgttgtggcaatgaaattcaaaaaataaaagtggctggt
cgggggacccacttttgcccattctgtcagcaaaaataa

DBGET integrated database retrieval system