KEGG   Lactococcus lactis subsp. lactis CV56: CVCAS_0436Help
Entry
CVCAS_0436        CDS       T01964                                 

Gene name
yejJ
Definition
family 3 glycosyl hydrolase (EC:3.2.1.52)
Orthology
K01207  
beta-N-acetylhexosaminidase [EC:3.2.1.52]
Organism
llt  Lactococcus lactis subsp. lactis CV56
Pathway
beta-Lactam resistance
Amino sugar and nucleotide sugar metabolism
Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:llt00001]
 Metabolism
  Carbohydrate metabolism
   00520 Amino sugar and nucleotide sugar metabolism
    CVCAS_0436 (yejJ)
 Human Diseases
  Drug resistance
   00312 beta-Lactam resistance
    CVCAS_0436 (yejJ)
Enzymes [BR:llt01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.52  beta-N-acetylhexosaminidase
     CVCAS_0436 (yejJ)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
448529..449740
Genome map
AA seq 403 aa AA seqDB search
MTKRLKKKAKPVVFLALVLGCALILSGVLGLAGHLNEQESSKTKKKSQLSETKRSSTSPK
NMDKNIEQMTLEQKVGQLFMTGMPANNYNQATFDAIEKYQVGSIILTGRSNLSVPEMKDI
TDKLQGLAPANRKLLISCDQEGGNVQVLQGQGFSQIPDGLTQGSWTADKLQKESQTWGSE
LYAAGVNFDLAPVADQVLSADFAPQNAPIGYWSRQYAYDKASIISHAQAFTEGMKAAKVL
TTAKHFPGLGAVTGNTDISAGVRDDQTNSNSESVQIFKDLISSGTPSIMTATAIYDKIDP
NLPGAFSSKMVDGLLRKQLGFDGLVITDDLSNAVQVQSWTPGQRAVLALSAGNDLVLANE
PTQIPEMISEVLQKVKADPDFAKKISQSATRVIKVKEEMKLVE
NT seq 1212 nt NT seq  +upstreamnt  +downstreamnt
atgactaagcgcttaaagaaaaaagcaaaaccagttgtttttctagctcttgttcttggt
tgtgcattaattttatcaggagttcttggtttggcgggacatttaaacgaacaagaatcg
tctaaaacaaaaaagaaaagtcaattgtcagaaactaaaaggagttcaacttccccaaaa
aatatggataaaaatattgagcagatgactttggaacaaaaagttggtcagttatttatg
acaggaatgccagcaaataactataatcaggcaacttttgatgcgattgaaaagtatcaa
gtaggtagtattattttgactggtcgctctaatctcagtgtcccagaaatgaaagatatt
actgacaaactacaaggcttagcaccggctaatcgcaaactcttgatatcctgtgaccaa
gagggaggaaatgttcaagttctccaaggtcagggtttttcacagattcctgatggatta
actcaaggaagttggacagctgataaattacaaaaggaatcacaaacttggggaagtgaa
ctttacgcagctggagtgaattttgacttagcaccagttgctgaccaagttttatctgcc
gactttgctccacaaaatgctccaattggctattggagtcgccaatatgcttatgataaa
gcaagtatcataagccatgctcaagcatttacggaaggcatgaaagcagccaaggttttg
acaactgctaaacattttccagggcttggagcggtgacaggcaatacagatatcagtgca
ggtgttagagatgaccaaacgaattccaatagcgaatctgttcaaattttcaaagattta
atctcttctgggacaccttcgattatgaccgcaaccgctatttatgataaaattgaccct
aatcttcccggtgctttttcatccaaaatggttgatggtttactacggaaacaattaggc
tttgatggtttggttattacagatgatttatcaaatgctgtccaagtacaatcatggacg
cctggtcaaagggcagttttagcattgtcagcaggaaatgaccttgttttagcaaatgag
cctacacaaattccagaaatgatctcagaagttttgcaaaaggtaaaagcagacccagac
tttgctaaaaaaatcagtcaatcagccacaagagtgattaaagtaaaagaagaaatgaaa
cttgtagaatag

DBGET integrated database retrieval system