KEGG   Lactococcus lactis subsp. lactis CV56: CVCAS_0650Help
Entry
CVCAS_0650        CDS       T01964                                 

Gene name
ygjD
Definition
4-alpha-glucanotransferase (EC:2.4.1.25)
Orthology
K00705  
4-alpha-glucanotransferase [EC:2.4.1.25]
Organism
llt  Lactococcus lactis subsp. lactis CV56
Pathway
Starch and sucrose metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:llt00001]
 Metabolism
  Carbohydrate metabolism
   00500 Starch and sucrose metabolism
    CVCAS_0650 (ygjD)
Enzymes [BR:llt01000]
 2. Transferases
  2.4  Glycosyltransferases
   2.4.1  Hexosyltransferases
    2.4.1.25  4-alpha-glucanotransferase
     CVCAS_0650 (ygjD)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
674947..676950
Genome map
AA seq 667 aa AA seqDB search
MLTNNFSIEPYGKKAYHTGIAVPVFSLRTENSSGVGQFSDLKELADFAHRSGMDIIQLLP
INDTSTFMDWRDSYPYRAISVFALHPIYLDIHIFWDSYTKIQQEKLLIAELELNALEKID
YEKALALKWEYAEIIYQNSAHKFKASKDYQQFYQQNEDWLKAYAAFSYLRDINQSANFMN
WGKYATYSEDFFEKLTSESNQLDLYIFVQYLLHYQLSEAVDYCHQLGIALKGDIAIGIAH
DSVDAWTHPELFHLDKQAGAPPDIFAVNGQNWGFPTYNWKKMAEDGYAWWKKRLTAMSNY
FDAYRLDHILGFFRIWQMPEDSVRGLLGQFSPAIALSAEEIENSYGIPLRQWGLERFINP
FIKDWVIDEIFGRDNRDWIIQTFLDYIGNGNYTFQNEYNNQKKVEKAQLEDWVREGLYKL
HENIILLKDDENPEKYHPRISLIQTISFREFGDDYKGRLEKLYNDYFYGRNYEFWKEKAY
EKLPVLKDATNMLACGEDLGMVPANVPDVMNHLNILRLIIERMPSDNRFVSPLNEVPYLS
VLTTSSHDTSPLRAWWEENHEEIQRYYNEVMGWYGEAPYYASAEIIQEIVKRHLNSNAMI
VILPIQDWLAMSEQLRKEDAKSEQINIPANPYHYWNYRLHCQLETLIDNQDWTEFLKKFI
KESKRAY
NT seq 2004 nt NT seq  +upstreamnt  +downstreamnt
atgctcaccaataatttttcaattgaaccttacggaaaaaaagcttaccatacagggata
gcagttccagttttttcactaagaactgaaaactcaagtggggtagggcaattttcagat
ttgaaagagttagccgattttgcccaccgttctgggatggacatcattcaattattacca
attaatgataccagtacttttatggactggcgtgattcatatccttatcgtgccatttct
gtttttgcattgcatccaatttatttagatattcacatcttttgggattcttacacaaaa
attcaacaagaaaagcttctcatcgcggaattagaattaaatgctttagaaaaaatagat
tatgaaaaagcattagccttaaaatgggaatatgctgaaattatttatcaaaactcagct
cataaatttaaagcaagcaaagattatcagcaattttatcagcaaaatgaggattggtta
aaggcctatgcggcattttcgtatttaagagatatcaatcaaagtgctaattttatgaat
tggggaaagtatgccacttatagtgaagatttctttgaaaagttaacttcagaaagtaat
caattggatttgtatatctttgtgcaataccttttgcattatcaactttcagaagccgtt
gactattgtcatcaattaggaattgcactaaaaggagatatcgcaattggaattgctcat
gattccgtagacgcttggactcatccagaactttttcatcttgataaacaagctggcgct
cctcctgatatttttgctgtaaatggacaaaattggggctttccaacctacaattggaaa
aaaatggccgaagatggttatgcatggtggaaaaaacggttaacagccatgtctaattat
tttgatgcttatcggctggaccatattcttggtttctttagaatatggcagatgccagag
gattccgtaagaggtttattgggccaattttcaccagctattgccttgtcagcagaagaa
attgaaaatagctatggtattccattaaggcaatggggcctcgagcggtttattaatcct
ttcatcaaggattgggtaattgatgaaatttttggccgagataatcgagattggattatt
caaacatttctggattatataggtaatggaaattatacatttcaaaatgagtataataac
cagaaaaaagtagaaaaagctcaattagaagattgggtgcgagaaggactttataaatta
catgaaaatataatattattaaaagatgatgagaatccagagaaatatcatccacgtatt
tctttaatacaaacaatcagctttcgagaatttggtgatgactataaaggacggcttgaa
aaactttataatgactatttttatggaaggaattatgaattttggaaagaaaaggcctat
gaaaaattaccagttttaaaagatgctacgaatatgttggcttgtggtgaagatttagga
atggttcccgccaatgtaccagatgtcatgaatcatcttaatattctacgtttgataatt
gagagaatgccttcagataatcgatttgtcagtcctttaaacgaagttccctatttatcg
gtcctaacgacttcaagtcacgatacaagtccactaagagcttggtgggaagaaaatcat
gaggaaattcaacgttactacaatgaagtcatgggttggtatggcgaagctccttattat
gcaagtgcagaaattatccaagagatagttaaaaggcatttaaactccaatgcgatgata
gttatcttacctattcaagattggttagcaatgagtgaacaattgcgaaaagaagatgca
aaatccgaacaaattaatattccagcaaatccataccattactggaattaccgattgcat
tgtcaacttgaaacattgattgataatcaggattggactgaatttttaaagaaatttatc
aaagaaagtaaaagagcctattaa

DBGET integrated database retrieval system