KEGG   Lactococcus lactis subsp. lactis CV56: CVCAS_1079Help
Entry
CVCAS_1079        CDS       T01964                                 

Gene name
ylbD
Definition
UDP-N-acetylmuramate--L-alanine ligase
Orthology
K01928  
UDP-N-acetylmuramoyl-L-alanyl-D-glutamate--2,6-diaminopimelate ligase [EC:6.3.2.13]
Organism
llt  Lactococcus lactis subsp. lactis CV56
Pathway
Lysine biosynthesis
Peptidoglycan biosynthesis
Class
Metabolism; Amino acid metabolism; Lysine biosynthesis [PATH:llt00300]
Metabolism; Glycan biosynthesis and metabolism; Peptidoglycan biosynthesis [PATH:llt00550]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(1099812..1101161)
Genome map
AA seq 449 aa AA seqDB search
MTIKTSFAKFAGNSSRFVLEKFFKRGSTLPGKIALKFDPEILKSLTKNYEIIVVTGTNGK
TLTTALTVGILEKAFGPVVTNPTGANMITGIVSTFLKAPKAKTGEKKFAVLEIDEASLPK
ITEYIKPSLFVFTNIFRDQMDRYGEIYTTYDFIVKGAANSPKGTVLLNGDSPLFNSKKLV
NPVKYYGFNHESHEPTHAHYNTEGIVCPVCHHILAYKMNTYANLGNYICENCGFSRPELD
YQLTELSEITNTSSKFVIDGTDYKINVGGLYNIYNALAAVSVAEYFNVPKETIAAGFELS
KAVFGRQETLEIDGKKVTIVLIKNPVGANQALEMMKLANYPFTLVSLLNANYADGIDTSW
IWDANFELINDMEIDQIITGGVRSSEMARRMRVTGFNAENISERKELSEVLEAIKESPKE
HVYILATYTAMLQMRELLAEGHYLGKEMR
NT seq 1350 nt NT seq  +upstreamnt  +downstreamnt
atgacaataaaaacttcatttgcaaagtttgctggtaattcatcgcgctttgtcttggaa
aaatttttcaagcgcggttcaactttaccaggaaaaattgctttaaaatttgatcctgaa
attcttaaatcactgacaaaaaattatgaaatcattgttgtgactgggacaaatggaaaa
acattgaccacagcactgaccgtgggaattctagaaaaggcttttggaccggttgtgaca
aatccaactggggctaatatgataacggggattgtatccacatttttgaaagctcccaaa
gcgaaaactggcgaaaaaaaatttgctgttcttgagattgatgaagcgagtttgccaaaa
atcactgaatatatcaaaccttcgttatttgtgtttactaatattttccgtgaccaaatg
gaccgctatggcgagatttatacaacttatgactttattgtcaagggtgcggcaaatagt
cctaaaggtacggttttgttaaatggcgatagtccacttttcaactcaaaaaaattagtt
aatcctgtaaaatactatggtttcaaccatgaaagccatgaacctactcatgctcattac
aatactgaggggattgtttgtccggtttgtcatcatattttggcttacaagatgaatacc
tatgctaacttaggaaattatatctgtgaaaattgtggttttagtcgtccagaattagat
tatcaactgacagaattatcagaaattacaaatacttcttctaaatttgtcattgatggg
acagattataaaattaatgttggcggactttataatatttataatgctcttgctgctgta
tctgtcgctgaatatttcaatgtgccaaaagaaacaattgcggctggttttgaactttct
aaagcagtttttggtcgtcaagaaacgcttgaaattgacggaaaaaaagtaaccattgtt
ttgattaaaaatccagtaggtgctaatcaagcccttgaaatgatgaaattagccaattat
cctttcactttagttagccttttaaatgccaattatgctgacggaattgacacaagttgg
atttgggatgctaattttgaattaattaatgatatggaaattgaccaaattatcacaggt
ggtgttcgttcatctgaaatggctagaagaatgcgtgtgacaggttttaatgccgaaaat
atttctgaacgcaaggaactttcagaagttttagaggcaattaaagagagtccaaaagag
catgtttatattttggcaacttacactgccatgttacaaatgcgtgaattattggctgag
ggtcattatcttggaaaggaaatgcgttaa

DBGET integrated database retrieval system