KEGG   Lactococcus lactis subsp. lactis CV56: CVCAS_1173Help
Entry
CVCAS_1173        CDS       T01964                                 

Gene name
hisD
Definition
(GenBank) histidinol dehydrogenase
  KO
K00013  histidinol dehydrogenase [EC:1.1.1.23]
Organism
llt  Lactococcus lactis subsp. lactis CV56
Pathway
llt00340  Histidine metabolism
llt01100  Metabolic pathways
llt01110  Biosynthesis of secondary metabolites
llt01230  Biosynthesis of amino acids
Module
llt_M00026  Histidine biosynthesis, PRPP => histidine
Brite
KEGG Orthology (KO) [BR:llt00001]
 Metabolism
  Amino acid metabolism
   00340 Histidine metabolism
    CVCAS_1173 (hisD)
Enzymes [BR:llt01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.23  histidinol dehydrogenase
     CVCAS_1173 (hisD)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Histidinol_dh DUF4735 Med11 Grg1
Motif
Other DBs
NCBI-ProteinID: ADZ63817
Position
1212685..1213980
Genome map
AA seq 431 aa AA seqDB search
MLKQIDYQGKLEEIAEKFQGRKTEVSKEVNKTVQQIVEDIQKSGDTALFNYAKKFDGYDV
NISNLLVTPMERETGLEQIDEDYFRILRRTKSQIEEFHKHQLENSWNIFKENGVIMGQIA
RPLERVALYVPGGTAAYPSTVIMNAVPALLAGVKEIIMITPVKADGKVNPNILAAAEVCG
IETIYKVGGAQGVAAVAYGTESIPKVDKIVGLGNIFVATAKKICYGVVDIDMIAGPSEVL
VIADKTANPKYIAADLMAQAEHDKLASAILVTTSEKLVQQVDEELNRQVQNLERREIIES
SIRNYGGAIVVKNIDEAFDVSNQLAPEHLEVLTSEPLTQLTKIKNAGSIFIGEYTPEPLG
DYMSGSNHVLPTGGTAKFYSGLGVYNFIKYLTYSYYPKEVLADFKEDVETFAKSEGLTAH
ANSISVRFDEM
NT seq 1296 nt NT seq  +upstreamnt  +downstreamnt
atgctcaaacaaattgattatcaaggaaagcttgaagaaattgctgaaaaatttcaaggt
cgaaaaacagaagtatcaaaagaagttaataaaactgttcaacagattgtagaagacatt
caaaaaagtggagatactgccttatttaactatgctaaaaagttcgatggttatgatgtg
aatattagtaatttactcgtcacgcccatggaacgtgaaacaggactagaacaaattgat
gaggattattttagaattcttagacgcaccaaatcacaaatcgaagaatttcataagcac
caactggaaaattcatggaatatttttaaggaaaatggtgttatcatgggacaaattgcg
cgtcctctggaacgtgttgctctctatgttcccggaggaacggctgcatatccctcaaca
gtcattatgaatgctgttccagcgcttttagcaggcgtcaaagaaattattatgattact
ccagttaaagctgatggaaaagtaaatccaaatattttagcagctgctgaagtttgtgga
atagaaacaatctataaggtgggtggagcacaaggcgttgctgccgttgcgtatgggaca
gaatctattcccaaagttgataagattgtcggacttggaaatatttttgtggctacagct
aagaaaatctgttatggggtggtagatattgatatgatagccggtccgtcagaagttcta
gttattgctgacaaaactgccaatccaaaatatatcgctgctgatttaatggcgcaagca
gaacatgataaacttgcgtcagcgattctagtgacgacttctgaaaaacttgttcaacaa
gtagatgaggaattaaatagacaagttcaaaatttggaacgtcgtgaaatcattgaaagt
tccatcaggaattacggtggagccattgttgtaaaaaatattgatgaagcctttgatgtt
tccaatcagctggctccagaacatttagaagttttgactagtgaacctttaacccaactt
acaaaaatcaaaaatgctggctcaatttttattggagagtatacgccagaaccgttaggc
gactatatgtcaggaagcaatcatgtcttaccaactggaggaacagccaaattttactct
ggtttgggtgtttataattttataaaatatttgacttatagctattatcctaaagaagtt
ttggctgactttaaagaggatgttgagacatttgcaaaatcagaaggattgacggctcat
gctaactcaatttctgtgagatttgatgaaatgtaa

DBGET integrated database retrieval system