KEGG   Lactococcus lactis subsp. lactis CV56: CVCAS_1306Help
Entry
CVCAS_1306        CDS       T01964                                 

Gene name
hasC
Definition
UTP--glucose-1-phosphate uridylyltransferase (EC:2.7.7.9)
Orthology
K00963  
UTP--glucose-1-phosphate uridylyltransferase [EC:2.7.7.9]
Organism
llt  Lactococcus lactis subsp. lactis CV56
Pathway
Pentose and glucuronate interconversions
Galactose metabolism
Starch and sucrose metabolism
Amino sugar and nucleotide sugar metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Class
Metabolism; Carbohydrate metabolism; Pentose and glucuronate interconversions [PATH:llt00040]
Metabolism; Carbohydrate metabolism; Galactose metabolism [PATH:llt00052]
Metabolism; Carbohydrate metabolism; Starch and sucrose metabolism [PATH:llt00500]
Metabolism; Carbohydrate metabolism; Amino sugar and nucleotide sugar metabolism [PATH:llt00520]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1361136..1362077
Genome map
AA seq 313 aa AA seqDB search
MKQNIIPTKARKVRKAVIPAAGLGTRFLPATKAIAKEMLPIVDKPTIQFIVEEALKSGIE
DILIVTGKAKRPIEDHFDSNIELEQNLLEKGKTELLKLVEETTDINLHFIRQSHPKGLGH
AVLQAKAFVGNEPFVVMLGDDLMNITGNETPLTKDLINDYEKTHASTIAVMKVPHDDVDK
YGVIDPNGEVSKGLYNVERFVEKPNVDEAPSDLAIIGRYLLTPEIFDVLETQVPGAGNEI
QLTDAIERLNKTQRVFAHEFTGKRYDVGDKLGFVETTIEYGLEHPQIGANLKNYIIEKAK
ELSKDDSKNITKK
NT seq 942 nt NT seq  +upstreamnt  +downstreamnt
atgaaacaaaacattattccaactaaagcccgaaaagtacgtaaagctgttattcctgcc
gctggtctcggaactcgctttttgccagcaactaaagcgattgccaaagaaatgttgcca
atcgtcgacaaacctactattcaatttatcgttgaagaagccttgaaatcaggaatcgaa
gatattttgattgttactggtaaagcaaaacgtcctattgaagaccattttgactcaaac
attgagcttgaacaaaatttgcttgaaaaaggaaaaacagaattacttaaacttgttgaa
gaaacgacagatattaatcttcactttatccgtcaatctcatccaaaaggattgggacat
gccgttcttcaagctaaagcttttgttggaaatgagccttttgtagtcatgcttggcgat
gacttgatgaatattactgggaatgaaactcctttaactaaagacctaatcaatgattat
gaaaaaactcacgcttcaacaatcgcggttatgaaagttcctcatgatgatgttgataaa
tatggtgtcattgaccctaacggtgaagtttctaaaggcctttacaatgttgaacgtttt
gtcgaaaaaccaaatgttgatgaagctccttctgaccttgcaattatcggtcgttacctc
ttaactcctgaaatttttgatgttttagaaacacaagttcccggtgcaggaaatgaaatc
caattgactgatgctatcgaacgtttgaataaaacacaacgcgtttttgctcatgaattt
actggaaaacgttatgatgttggtgataaacttggttttgttgaaacaacaattgaatat
ggtttagaacacccacaaatcggtgcgaatttgaaaaactacatcattgaaaaagcaaaa
gagctttctaaagatgactcaaaaaatatcactaaaaaataa

DBGET integrated database retrieval system