KEGG   Lactococcus lactis subsp. lactis CV56: CVCAS_1370Help
Entry
CVCAS_1370        CDS       T01964                                 

Gene name
trpB
Definition
(GenBank) tryptophan synthase beta chain
  KO
K01696  tryptophan synthase beta chain [EC:4.2.1.20]
Organism
llt  Lactococcus lactis subsp. lactis CV56
Pathway
llt00260  Glycine, serine and threonine metabolism
llt00400  Phenylalanine, tyrosine and tryptophan biosynthesis
llt01100  Metabolic pathways
llt01110  Biosynthesis of secondary metabolites
llt01130  Biosynthesis of antibiotics
llt01230  Biosynthesis of amino acids
Module
llt_M00023  Tryptophan biosynthesis, chorismate => tryptophan
Brite
KEGG Orthology (KO) [BR:llt00001]
 Metabolism
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    CVCAS_1370 (trpB)
   00400 Phenylalanine, tyrosine and tryptophan biosynthesis
    CVCAS_1370 (trpB)
Enzymes [BR:llt01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.20  tryptophan synthase
     CVCAS_1370 (trpB)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PALP
Motif
Other DBs
NCBI-ProteinID: ADZ64007
Position
complement(1425545..1426753)
Genome map
AA seq 402 aa AA seqDB search
MTYNQPNNKGFYGQFGGQFVPETLMTAVKQLEEAYVDSKKDPLFQAELKELLKDYVGREN
PLYYAKRLTEYAGGAKIYLKREDLNHTGAHKINNALGQVLLAKKMGKNKVIAETGAGQHG
VASATAAALFGMECTIYMGEEDVKRQSLNVFRMELLGAKVHSVTDGSRVLKDAVNAALRA
WVAQVEDTHYVMGSVLGPHPFPQIVRDYQAVIGQEARAQFLEKENKLPDALVACVGGGSN
SMGLFYPFVNDESVAMYGVEAAGLGIDTPHHAATITKGRPGVLHGTLMDVLQDENGQILE
AFSISAGLDYPGIGPEHSYFNAVGRAKYVDITDEEALEGFKILSRTEGIIPALESSHAIA
YAVKLAKELGADKSMIVCLSGRGDKDVVQVKERLEAEKEVKK
NT seq 1209 nt NT seq  +upstreamnt  +downstreamnt
atgacctacaaccaacctaacaacaaaggattttacggccaattcgggggccaattcgta
cctgagacactaatgacagcagtaaaacaattagaagaagcctacgtagatagtaaaaaa
gaccctctctttcaagcagaacttaaagaattacttaaagactatgttggacgagaaaac
ccactctattatgcaaaacgcttaacagaatatgcgggcggagcaaaaatttatcttaaa
agagaagacctaaaccatacaggagcacacaaaattaacaatgccctcggacaagtcctc
cttgccaaaaaaatgggaaaaaataaagtcattgctgaaacaggtgcaggccaacacggt
gtcgcaagcgcaaccgcggctgccctctttggcatggaatgtacgatttatatgggtgaa
gaagacgttaaaagacaatctctcaatgtctttcgcatggaattactcggggcaaaagtt
cattcagtaactgatggttcacgcgtacttaaagatgcggttaatgcagcacttagagca
tgggttgctcaagttgaagatacgcattatgtaatgggctcagttcttggaccacatcca
tttccacaaattgtgcgtgattatcaagctgttattggacaggaagcgcgtgcccaattt
ttagaaaaagaaaataaacttccagatgctttagtagcttgtgtcggtggaggttcaaat
tctatgggacttttttatcccttcgttaatgatgaatcagttgccatgtatggtgttgaa
gccgctggccttgggattgatacaccacatcatgcggcaacaattactaaaggccgcccc
ggtgttcttcacggaacactcatggatgtccttcaagatgaaaatggtcaaatcttagaa
gcctttagtatttcagccggtttagactatccaggaatcggaccagaacactcttatttc
aatgctgttggacgagcaaaatatgttgatattacagatgaagaagcacttgaaggtttt
aaaatcttatctagaactgaaggaattatcccagcactagaaagttctcatgctatcgcc
tatgcagtcaaattagcaaaagaattaggagcagataaatcaatgattgtttgtctttca
ggacgtggagataaggatgtggttcaagttaaagaacgacttgaagcagaaaaagaggtg
aaaaaatga

DBGET integrated database retrieval system