KEGG   Lactococcus lactis subsp. lactis CV56: CVCAS_1370Help
Entry
CVCAS_1370        CDS       T01964                                 

Gene name
trpB
Definition
tryptophan synthase beta chain (EC:4.2.1.20)
Orthology
K01696  
tryptophan synthase beta chain [EC:4.2.1.20]
Organism
llt  Lactococcus lactis subsp. lactis CV56
Pathway
Glycine, serine and threonine metabolism
Phenylalanine, tyrosine and tryptophan biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Biosynthesis of amino acids
Module
Tryptophan biosynthesis, chorismate => tryptophan
Brite
KEGG Orthology (KO) [BR:llt00001]
 Metabolism
  Overview
   01230 Biosynthesis of amino acids
    CVCAS_1370 (trpB)
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    CVCAS_1370 (trpB)
   00400 Phenylalanine, tyrosine and tryptophan biosynthesis
    CVCAS_1370 (trpB)
Enzymes [BR:llt01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.20  tryptophan synthase
     CVCAS_1370 (trpB)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(1425545..1426753)
Genome map
AA seq 402 aa AA seqDB search
MTYNQPNNKGFYGQFGGQFVPETLMTAVKQLEEAYVDSKKDPLFQAELKELLKDYVGREN
PLYYAKRLTEYAGGAKIYLKREDLNHTGAHKINNALGQVLLAKKMGKNKVIAETGAGQHG
VASATAAALFGMECTIYMGEEDVKRQSLNVFRMELLGAKVHSVTDGSRVLKDAVNAALRA
WVAQVEDTHYVMGSVLGPHPFPQIVRDYQAVIGQEARAQFLEKENKLPDALVACVGGGSN
SMGLFYPFVNDESVAMYGVEAAGLGIDTPHHAATITKGRPGVLHGTLMDVLQDENGQILE
AFSISAGLDYPGIGPEHSYFNAVGRAKYVDITDEEALEGFKILSRTEGIIPALESSHAIA
YAVKLAKELGADKSMIVCLSGRGDKDVVQVKERLEAEKEVKK
NT seq 1209 nt NT seq  +upstreamnt  +downstreamnt
atgacctacaaccaacctaacaacaaaggattttacggccaattcgggggccaattcgta
cctgagacactaatgacagcagtaaaacaattagaagaagcctacgtagatagtaaaaaa
gaccctctctttcaagcagaacttaaagaattacttaaagactatgttggacgagaaaac
ccactctattatgcaaaacgcttaacagaatatgcgggcggagcaaaaatttatcttaaa
agagaagacctaaaccatacaggagcacacaaaattaacaatgccctcggacaagtcctc
cttgccaaaaaaatgggaaaaaataaagtcattgctgaaacaggtgcaggccaacacggt
gtcgcaagcgcaaccgcggctgccctctttggcatggaatgtacgatttatatgggtgaa
gaagacgttaaaagacaatctctcaatgtctttcgcatggaattactcggggcaaaagtt
cattcagtaactgatggttcacgcgtacttaaagatgcggttaatgcagcacttagagca
tgggttgctcaagttgaagatacgcattatgtaatgggctcagttcttggaccacatcca
tttccacaaattgtgcgtgattatcaagctgttattggacaggaagcgcgtgcccaattt
ttagaaaaagaaaataaacttccagatgctttagtagcttgtgtcggtggaggttcaaat
tctatgggacttttttatcccttcgttaatgatgaatcagttgccatgtatggtgttgaa
gccgctggccttgggattgatacaccacatcatgcggcaacaattactaaaggccgcccc
ggtgttcttcacggaacactcatggatgtccttcaagatgaaaatggtcaaatcttagaa
gcctttagtatttcagccggtttagactatccaggaatcggaccagaacactcttatttc
aatgctgttggacgagcaaaatatgttgatattacagatgaagaagcacttgaaggtttt
aaaatcttatctagaactgaaggaattatcccagcactagaaagttctcatgctatcgcc
tatgcagtcaaattagcaaaagaattaggagcagataaatcaatgattgtttgtctttca
ggacgtggagataaggatgtggttcaagttaaagaacgacttgaagcagaaaaagaggtg
aaaaaatga

DBGET integrated database retrieval system