KEGG   Lactococcus lactis subsp. lactis CV56: CVCAS_1399Help
Entry
CVCAS_1399        CDS       T01964                                 

Gene name
lnbA
Definition
lacto-N-biosidase (EC:3.2.1.52)
Orthology
K12373  
hexosaminidase [EC:3.2.1.52]
Organism
llt  Lactococcus lactis subsp. lactis CV56
Pathway
Other glycan degradation
Amino sugar and nucleotide sugar metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:llt00001]
 Metabolism
  Carbohydrate metabolism
   00520 Amino sugar and nucleotide sugar metabolism
    CVCAS_1399 (lnbA)
  Glycan biosynthesis and metabolism
   00511 Other glycan degradation
    CVCAS_1399 (lnbA)
Enzymes [BR:llt01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.52  beta-N-acetylhexosaminidase
     CVCAS_1399 (lnbA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(1457252..1458229)
Genome map
AA seq 325 aa AA seqDB search
MEKGLLVDIGRKYWSIAELKRLVLLLQEHKLTHLQLHLNENEGFALNFTDSPVSKKYSEN
MLKELKEFAKTHEITLIPDFDSPGHMGSLLEQNPEFALPDSNQQAVDVTNPAVIDWIMGI
IDKIVDIFPDSDTFHIGADEFIDFRQIEKYPYLVEKTREKYGNKASGLEFYYDYVNQLTE
HLQKKGKQVRIWNDGFLRKDLQSLVPLNKNVEVCYWTNWDKGMAEVKEWLTKGYTLINFC
DNDLYYVLGEEAGYSYPTAEKLEREGKIQKFSGQQYLNQEEMKAVRGTYFSIWADNAAAK
SVSEILDDLSKVLPVFMKIYGGNDE
NT seq 978 nt NT seq  +upstreamnt  +downstreamnt
atggaaaaaggattattagtcgatattggacgaaaatattggtcaatagcagagttaaaa
agattagttcttttacttcaagagcataagctgacacatttacaacttcatctcaatgaa
aatgaaggatttgcgctaaattttactgacagccctgtcagtaaaaaatattcagaaaat
atgctcaaagaattgaaagaatttgcaaaaacacacgaaatcactttgattcctgatttt
gatagtccaggtcacatgggctccttattagagcaaaatcctgaatttgcactacctgac
agcaatcaacaagcggtagatgttactaatccagcagtcattgattggattatgggaata
attgataagatagtcgatattttcccagattcagatacttttcatatcggggctgatgaa
tttattgattttcggcaaattgaaaaatatccttatttagtggagaaaactcgggaaaaa
tatggaaataaggcaagtggtttagagttttattatgactatgttaatcaattgaccgag
catttgcagaaaaaaggaaaacaagttcgtatttggaatgatggatttttacgaaaagac
cttcagtcattggttcctttgaataaaaatgtggaggtttgttattggacaaactgggac
aaagggatggcagaagtcaaagaatggttaactaagggttataccttaataaatttttgt
gataatgacctttattatgttttaggtgaagaagcaggctattcttatccaacggctgaa
aaactggaaagggaaggaaaaattcaaaaattttctggtcagcaatatttaaatcaagaa
gagatgaaagctgtcagaggaacttacttttcgatttgggctgacaatgctgcagctaag
tctgtcagtgaaattttagacgatcttagcaaggtacttccggtatttatgaaaatttat
ggaggaaatgatgaataa

DBGET integrated database retrieval system