KEGG   Lactococcus lactis subsp. lactis CV56: CVCAS_1580Help
Entry
CVCAS_1580        CDS       T01964                                 

Gene name
arb
Definition
6-phospho-beta-glucosidase (EC:3.2.1.86)
Orthology
K01223  
6-phospho-beta-glucosidase [EC:3.2.1.86]
Organism
llt  Lactococcus lactis subsp. lactis CV56
Pathway
Glycolysis / Gluconeogenesis
Brite
KEGG Orthology (KO) [BR:llt00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    CVCAS_1580 (arb)
Enzymes [BR:llt01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.86  6-phospho-beta-glucosidase
     CVCAS_1580 (arb)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(1649952..1651385)
Genome map
AA seq 477 aa AA seqDB search
MPFSKDFLWGGATAANQCEGGYNQGGRGLANVDLVPHGKDRFPIITGEMKHLEFDEEHFY
PAKEAIDMYHHWKEDLALFAEMGFKTYRMSIAWTRIFPKGDEQEPNEEGLQFYEDIFREC
QRLGIEPLVTITHFDCPVHLIKEYGGWRNRKMVGFYENLARAIFTRYKGLVRYWLTFNEI
NMLLHAPFMGAGLVFEEGENKEQAKYLAAHHELLASALATKIGHEVDPENKIGCMLAAGD
YYPFDCNPENVFEAQKQNHDNLFFIDVQSRGKYPNYLLKRLEREEITLPIEKGDLEILSE
NTVDFISFSYYASRVAKVKDEDADKSAGNIFESVKNPYLEASEWGWQIDPLGLRITMNSI
YDRYQKPLFIVENGLGAVDKPDENGFVADDYRIDYMAAHIKEMKKAVELDGVELLGYTSW
GCIDLVSAGTGEMSKRYGFIYVDRDDYGKGSLKRTPKKSFNWYKKVIASNGEDLTNE
NT seq 1434 nt NT seq  +upstreamnt  +downstreamnt
atgccatttagtaaagattttctctggggcggagcaactgcagctaatcaatgtgaaggc
ggctataatcagggaggacgggggcttgccaatgtcgaccttgttccacacggaaaagac
cgttttccaattattacaggggaaatgaagcaccttgaattcgatgaagagcatttttat
ccagcaaaagaagcgattgatatgtatcatcattggaaagaagacctcgcactttttgct
gaaatgggatttaaaacctatcgaatgtctattgcttggacaagaatttttccaaaaggc
gacgaacaagagccaaatgaagaaggcttgcaattttatgaagatatttttagagaatgc
caacgtttaggaattgaacccttagtaaccatcactcactttgattgtcctgtccaccta
attaaagaatacggtggctggcgtaatcgaaaaatggttggtttctatgaaaatttagcc
agagcaatttttactcgttataaaggattagttcgctattggttgacatttaatgaaatt
aatatgctcctccatgctccatttatgggagcaggacttgtttttgaagaaggagaaaat
aaagaacaagccaaatacttagccgctcatcatgaactattagcatcggctttagcaaca
aaaattggacatgaagttgacccagaaaataagataggctgcatgttagctgctggagat
tactatccatttgattgtaatccagaaaatgtttttgaagctcaaaaacaaaatcatgat
aatctctttttcattgatgttcaatctcgtggaaaatatccaaactaccttttaaagaga
ttagagcgtgaagaaattacacttccgattgaaaaaggcgacttagaaatcctttctgaa
aacacagttgactttatttcatttagttactatgcaagtcgagtcgctaaagtcaaggat
gaggatgcagataaatcagctggaaatatctttgaatctgtaaaaaatccttatttagag
gccagtgaatggggttggcaaattgacccacttggtttaagaatcacaatgaattctatt
tatgaccgctatcaaaaaccattatttattgtagaaaatggtttaggagcagtagataaa
cctgatgaaaatggatttgtagctgatgattatcgaattgattacatggctgcacacatc
aaagaaatgaagaaagcagttgaacttgatggcgttgaactattaggttatacttcttgg
ggatgtattgacttagtatcagcaggaacgggtgagatgagcaaacgttatggattcatc
tatgtcgaccgagacgattatggtaaaggaagtttgaaacggacgcctaagaaatcattt
aactggtacaagaaagttattgcaagcaacggtgaagatttaacaaatgaataa

DBGET integrated database retrieval system