KEGG   Lactococcus lactis subsp. lactis CV56: CVCAS_1588Help
Entry
CVCAS_1588        CDS       T01964                                 

Gene name
amyY
Definition
alpha-amylase (EC:3.2.1.1)
Orthology
K01176  
alpha-amylase [EC:3.2.1.1]
Organism
llt  Lactococcus lactis subsp. lactis CV56
Pathway
Starch and sucrose metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:llt00001]
 Metabolism
  Carbohydrate metabolism
   00500 Starch and sucrose metabolism
    CVCAS_1588 (amyY)
Enzymes [BR:llt01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.1  alpha-amylase
     CVCAS_1588 (amyY)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(1661175..1662749)
Genome map
AA seq 524 aa AA seqDB search
MKNKLLLLSVTLLATCALSACQKANSKDSSVKKAAVSQKVDRSLYRNFYEIFTSSFADSN
HDGEGDLNGVTQHLDYLNTGKSNSTTDLKVQGLWMTPIFASPSYHGYDVTNYEEINPKFG
TMADFENLIAQAKKRGIAVILDMPFNHTATDNIWFQKALSGDKKYVDYYNWSDTAEEGYS
LASNGKYYESEFDKSMPDLNLANPEVKKEIAKITKLWLDKGVSGFRLDAVGFYFSNDDKK
TTAFTKWLTDTVKKQNPKAYLVGEVFSTASAIDDIYQSGIDSLFDFPNALQSSSSPINSA
LVLGEGSLFGQQIEAWDQEIHADNPKAIDAPFLSNHDTDRSATLLSSLSMQKMAAQTYLL
MPGNPFIYYGEELGLTGSGIDQNKRLPMPWNAAGTDSPKADISVPGATEIATTDGGSVAQ
QEANPNSLLNWYKKILRVKAKYPEIATDRLKNISVSEESLSVINYGKDLTIINNFSDTEN
VTMKLPKSIVGTKITDQLSVSSSQAKLTDGKLTIPAYSTVILKK
NT seq 1575 nt NT seq  +upstreamnt  +downstreamnt
atgaaaaataagcttttacttctgtcagtaactttactggcgacgtgtgctttaagtgct
tgtcaaaaagcaaattcaaaagattcatcagtaaaaaaagcggctgtcagccaaaaggtt
gataggagtttgtatcgtaatttttatgaaatatttacgagttcatttgccgattcaaat
catgatggcgaaggtgatttaaatggggtcacgcaacatttagactacttgaatactgga
aaatccaattctacaacggatttgaaagtgcaaggactttggatgacaccgatttttgct
agtcctagttatcatggctatgatgtcactaattacgaagaaattaatcccaagtttggg
acaatggctgattttgaaaatctgattgctcaagctaaaaaacgaggaattgctgtgatt
ttggatatgccatttaaccacacggcgactgataatatctggtttcaaaaagcactatct
ggcgacaaaaaatatgtggattattataattggtcagatacagccgaagagggttatagt
ttagccagcaacggcaaatactatgagtcagagtttgataaatcgatgccagacctcaat
cttgctaatcctgaggtcaaaaaagaaattgcaaaaattacgaaactttggttggacaaa
ggtgtttctggtttccgtttggatgctgtcggtttttatttctcaaatgatgataaaaaa
acgacagctttcacaaaatggctgacagacacggtcaaaaagcaaaatccaaaagcttat
ttagtgggtgaagttttttcaacggcttcggcaattgatgatatttatcagtcaggtatt
gattcattatttgactttccgaatgctttgcaatcgagttcaagtccaattaattcagct
ttagtcttaggtgaaggctctttatttggtcaacaaattgaagcatgggaccaagaaatt
catgcggataacccgaaagccattgacgctcctttcttgagtaatcatgacacagaccga
tctgcaacacttttaagttctttatccatgcagaaaatggctgctcaaacttatcttttg
atgccgggaaatccatttatttactacggtgaggaattggggctgacaggttctggcatt
gaccaaaataaacgtttgccaatgccttggaatgctgctgggacagattctcccaaagca
gacatttctgtgccaggtgcgacagaaattgccacaactgacggaggctcagtagctcaa
caagaagccaatccgaactcactgctcaattggtacaaaaaaattttacgggtcaaagca
aaatatcctgaaattgcgactgacagattgaaaaatatttctgtcagtgaagagagcttg
tctgtcattaattatggaaaggatttgactattatcaataatttttccgatacagaaaat
gtgacaatgaaactcccaaaaagcattgttgggacaaaaatcactgaccaactttctgtc
agtagttctcaagcaaaattaactgatggaaaattgacaattccagcttacagcaccgtt
attttaaaaaaataa

DBGET integrated database retrieval system