KEGG   Lactococcus lactis subsp. lactis CV56: CVCAS_1624Help
Entry
CVCAS_1624        CDS       T01964                                 

Gene name
yrgI
Definition
(RefSeq) phosphoglycerate mutase family protein
  KO
K01834  
2,3-bisphosphoglycerate-dependent phosphoglycerate mutase [EC:5.4.2.11]
Organism
llt  Lactococcus lactis subsp. lactis CV56
Pathway
Glycolysis / Gluconeogenesis
Glycine, serine and threonine metabolism
Methane metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Biosynthesis of antibiotics
Carbon metabolism
Biosynthesis of amino acids
Module
Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
Glycolysis, core module involving three-carbon compounds
Brite
KEGG Orthology (KO) [BR:llt00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    CVCAS_1624 (yrgI)
   01230 Biosynthesis of amino acids
    CVCAS_1624 (yrgI)
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    CVCAS_1624 (yrgI)
  Energy metabolism
   00680 Methane metabolism
    CVCAS_1624 (yrgI)
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    CVCAS_1624 (yrgI)
Enzymes [BR:llt01000]
 5. Isomerases
  5.4  Intramolecular transferases
   5.4.2  Phosphotransferases (phosphomutases)
    5.4.2.11  phosphoglycerate mutase (2,3-diphosphoglycerate-dependent)
     CVCAS_1624 (yrgI)
Exosome [BR:llt04147]
 Exosomal proteins
  Exosomal proteins of bladder cancer cells
   CVCAS_1624 (yrgI)
  Exosomal proteins of melanoma cells
   CVCAS_1624 (yrgI)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1696802..1697269
Genome map
AA seq 155 aa AA seqDB search
MADAFANVSIEQIFSSPFQRSVRTLNPLAHSKNLEIQLISDFRERNVGHEIADFWPFAKQ
QWNDFDYKFADGESLREVQNRNISALEQILTTSKNQKVAIGTHGTSLSTILNFYQPDFQF
QDFQSLAGKMPYVIKMDFAENKYLTHQVIEIDYEQ
NT seq 468 nt NT seq  +upstreamnt  +downstreamnt
ttggctgatgcttttgcaaatgtatcaatcgagcaaattttttccagtccatttcaacgt
tctgttcgtaccctgaatcctcttgctcactctaaaaatcttgaaattcaactcatttct
gattttagagaaagaaatgttggccatgaaatagctgatttttggccctttgctaagcaa
caatggaatgattttgattataaatttgctgacggagaatccttacgtgaagttcaaaat
cgtaatatttcagcccttgaacagattttaacaacttctaaaaatcaaaaagttgcaatc
ggaacacatggtacttctctttctaccattttaaatttttatcaaccagactttcagttt
caagattttcaatctttagctggaaagatgccctatgtcatcaaaatggactttgctgaa
aataaatatctgacccaccaagtcattgaaattgattatgagcaataa

DBGET integrated database retrieval system