KEGG   Lactococcus lactis subsp. lactis CV56: CVCAS_1741Help
Entry
CVCAS_1741        CDS       T01964                                 

Gene name
adhA
Definition
(GenBank) alcohol dehydrogenase
  KO
K13953  alcohol dehydrogenase, propanol-preferring [EC:1.1.1.1]
Organism
llt  Lactococcus lactis subsp. lactis CV56
Pathway
llt00010  Glycolysis / Gluconeogenesis
llt00071  Fatty acid degradation
llt00350  Tyrosine metabolism
llt00625  Chloroalkane and chloroalkene degradation
llt00626  Naphthalene degradation
llt01100  Metabolic pathways
llt01110  Biosynthesis of secondary metabolites
llt01120  Microbial metabolism in diverse environments
llt01130  Biosynthesis of antibiotics
llt01220  Degradation of aromatic compounds
Brite
KEGG Orthology (KO) [BR:llt00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    CVCAS_1741 (adhA)
  Lipid metabolism
   00071 Fatty acid degradation
    CVCAS_1741 (adhA)
  Amino acid metabolism
   00350 Tyrosine metabolism
    CVCAS_1741 (adhA)
  Xenobiotics biodegradation and metabolism
   00625 Chloroalkane and chloroalkene degradation
    CVCAS_1741 (adhA)
   00626 Naphthalene degradation
    CVCAS_1741 (adhA)
Enzymes [BR:llt01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.1  alcohol dehydrogenase
     CVCAS_1741 (adhA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ADH_N ADH_zinc_N ADH_zinc_N_2 TrkA_N DZR Methyltransf_25 2-Hacid_dh_C Methyltransf_31
Motif
Other DBs
NCBI-ProteinID: ADZ64367
Structure
PDB: 

Jmol
Position
complement(1812677..1813699)
Genome map
AA seq 340 aa AA seqDB search
MKAAVVRHNPDGYADLVEKELRAIKPNEALLDMEYCGVCHTDLHVAAGDYGNKAGTVLGH
EGIGIVKEIGTDVSSLQVGDRVSVAWFFEGCGHCEYCVSGNETFCREVKNAGYSVDGGMA
EEAIVVADYAVKVPDGLDPIEASSITCAGVTTYKAIKVSGVKPGDWQVIFGAGGLGNLAI
QYAKNVFGAKVIAVDINQDKLNLAKKIGADVIINSGDVNPVDEIKKITGGLGAQSAIVCA
VARIAFEQAVASLKPMGKMVAVALPNTEMTLSVPTVVFDGVEVAGSLVGTRLDLAEAFQF
GAEGKVKPIVATRKLEEINDIIDEMKAGKIEGRMVIDFTK
NT seq 1023 nt NT seq  +upstreamnt  +downstreamnt
atgaaagcagcagtagtaagacacaatccagatggttatgcggaccttgttgaaaaggaa
cttcgagcaatcaaacctaatgaagctttgcttgacatggagtattgtggagtctgtcat
accgatttgcacgttgcagcaggtgattatggcaacaaagcagggactgttcttggtcat
gaaggaattggaattgtcaaagaaattggaactgatgtaagctcgcttcaagttggtgat
cgggtttcagtggcttggttctttgaaggatgtggtcactgtgaatactgtgtatctggt
aatgaaactttttgtcgagaagttaaaaatgcaggatattcagttgatggcggaatggct
gaagaagcaattgttgttgccgattatgctgtcaaagttcctgacggacttgacccaatt
gaagctagctcaattacttgtgctggagtaacaacttacaaagcaatcaaagtatcagga
gtaaaacctggtgattggcaagtaatttttggtgctggaggacttggaaatttagcaatt
caatatgctaaaaatgtttttggagcaaaagtaattgctgttgatattaatcaagataaa
ttaaatttagctaaaaaaattggagctgatgtgattatcaattctggtgatgtaaatcca
gttgatgaaattaaaaaaataactggcggcttaggagcacaaagtgcaatagtttgtgct
gttgcaaggattgcttttgaacaagcggttgcttctttgaaacctatgggcaaaatggtt
gctgtggcacttcccaatactgagatgactttatcagttccaacagttgtttttgacgga
gtggaggttgcaggttcacttgtcggaacaagacttgacttggcagaagcttttcaattt
ggagcagagggtaaggtaaaaccaattgttgcgacacgcaaactggaagaaatcaatgat
attattgatgaaatgaaggcaggaaaaattgaaggccgaatggtcattgattttactaaa
taa

DBGET integrated database retrieval system