KEGG   Lactococcus lactis subsp. lactis CV56: CVCAS_1741Help
Entry
CVCAS_1741        CDS       T01964                                 

Gene name
adhA
Definition
alcohol dehydrogenase (EC:1.1.1.1)
Orthology
K13953  
alcohol dehydrogenase, propanol-preferring [EC:1.1.1.1]
Organism
llt  Lactococcus lactis subsp. lactis CV56
Pathway
Glycolysis / Gluconeogenesis
Fatty acid degradation
Tyrosine metabolism
Chloroalkane and chloroalkene degradation
Naphthalene degradation
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Degradation of aromatic compounds
Brite
KEGG Orthology (KO) [BR:llt00001]
 Metabolism
  Overview
   01220 Degradation of aromatic compounds
    CVCAS_1741 (adhA)
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    CVCAS_1741 (adhA)
  Lipid metabolism
   00071 Fatty acid degradation
    CVCAS_1741 (adhA)
  Amino acid metabolism
   00350 Tyrosine metabolism
    CVCAS_1741 (adhA)
  Xenobiotics biodegradation and metabolism
   00625 Chloroalkane and chloroalkene degradation
    CVCAS_1741 (adhA)
   00626 Naphthalene degradation
    CVCAS_1741 (adhA)
Enzymes [BR:llt01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.1  alcohol dehydrogenase
     CVCAS_1741 (adhA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(1812677..1813699)
Genome map
AA seq 340 aa AA seqDB search
MKAAVVRHNPDGYADLVEKELRAIKPNEALLDMEYCGVCHTDLHVAAGDYGNKAGTVLGH
EGIGIVKEIGTDVSSLQVGDRVSVAWFFEGCGHCEYCVSGNETFCREVKNAGYSVDGGMA
EEAIVVADYAVKVPDGLDPIEASSITCAGVTTYKAIKVSGVKPGDWQVIFGAGGLGNLAI
QYAKNVFGAKVIAVDINQDKLNLAKKIGADVIINSGDVNPVDEIKKITGGLGAQSAIVCA
VARIAFEQAVASLKPMGKMVAVALPNTEMTLSVPTVVFDGVEVAGSLVGTRLDLAEAFQF
GAEGKVKPIVATRKLEEINDIIDEMKAGKIEGRMVIDFTK
NT seq 1023 nt NT seq  +upstreamnt  +downstreamnt
atgaaagcagcagtagtaagacacaatccagatggttatgcggaccttgttgaaaaggaa
cttcgagcaatcaaacctaatgaagctttgcttgacatggagtattgtggagtctgtcat
accgatttgcacgttgcagcaggtgattatggcaacaaagcagggactgttcttggtcat
gaaggaattggaattgtcaaagaaattggaactgatgtaagctcgcttcaagttggtgat
cgggtttcagtggcttggttctttgaaggatgtggtcactgtgaatactgtgtatctggt
aatgaaactttttgtcgagaagttaaaaatgcaggatattcagttgatggcggaatggct
gaagaagcaattgttgttgccgattatgctgtcaaagttcctgacggacttgacccaatt
gaagctagctcaattacttgtgctggagtaacaacttacaaagcaatcaaagtatcagga
gtaaaacctggtgattggcaagtaatttttggtgctggaggacttggaaatttagcaatt
caatatgctaaaaatgtttttggagcaaaagtaattgctgttgatattaatcaagataaa
ttaaatttagctaaaaaaattggagctgatgtgattatcaattctggtgatgtaaatcca
gttgatgaaattaaaaaaataactggcggcttaggagcacaaagtgcaatagtttgtgct
gttgcaaggattgcttttgaacaagcggttgcttctttgaaacctatgggcaaaatggtt
gctgtggcacttcccaatactgagatgactttatcagttccaacagttgtttttgacgga
gtggaggttgcaggttcacttgtcggaacaagacttgacttggcagaagcttttcaattt
ggagcagagggtaaggtaaaaccaattgttgcgacacgcaaactggaagaaatcaatgat
attattgatgaaatgaaggcaggaaaaattgaaggccgaatggtcattgattttactaaa
taa

DBGET integrated database retrieval system