KEGG   Lactococcus lactis subsp. lactis CV56: CVCAS_2012Help
Entry
CVCAS_2012        CDS       T01964                                 

Gene name
glk
Definition
glucokinase (EC:2.7.1.2)
Orthology
K00845  
glucokinase [EC:2.7.1.2]
Organism
llt  Lactococcus lactis subsp. lactis CV56
Pathway
Glycolysis / Gluconeogenesis
Galactose metabolism
Starch and sucrose metabolism
Amino sugar and nucleotide sugar metabolism
Streptomycin biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Module
Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
Brite
KEGG Orthology (KO) [BR:llt00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    CVCAS_2012 (glk)
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    CVCAS_2012 (glk)
   00052 Galactose metabolism
    CVCAS_2012 (glk)
   00500 Starch and sucrose metabolism
    CVCAS_2012 (glk)
   00520 Amino sugar and nucleotide sugar metabolism
    CVCAS_2012 (glk)
  Biosynthesis of other secondary metabolites
   00521 Streptomycin biosynthesis
    CVCAS_2012 (glk)
   00524 Butirosin and neomycin biosynthesis
    CVCAS_2012 (glk)
Enzymes [BR:llt01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.2  glucokinase
     CVCAS_2012 (glk)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
2062723..2063694
Genome map
AA seq 323 aa AA seqDB search
MTASKIIGIDLGGTSIKFGILTLDGEVQDKWSIPTNILEDGKHIVPDIIESINHRLSLYN
LDKSEFLGIGMGTPGSVNISESTVKAAFNLNWADTQEVGKPISEGVGLPFILDNDANVAA
LGERWVGAGENNPDVVFITLGTGVGGGIIASGELVHGVAGAGGEIGHICVDPYGFECTCG
NRGCLETVTSATGIVRLARKFAEEYEGDSTIKAAIDNGDEVTSKDIFFAAQEGDHFSLSV
VDKFAYYLGFACANLGSTLNPASIVIGGGVSAAGEFLREKVEKYFTKYAFSTVRNSSKIK
LAVLGNDAGIIGAASLALKFKGE
NT seq 972 nt NT seq  +upstreamnt  +downstreamnt
atgactgcaagtaaaattatcggtatcgaccttggtggaacttcaattaaatttggaatt
ttgacactcgatggtgaggttcaagataaatggtctatcccgacaaatattttagaagat
ggaaaacatatcgttcctgatattattgaatcaatcaaccaccgtttaagcctttataac
ttggacaaatctgaatttcttggaattggaatgggaacaccaggttcagtaaatatttct
gaaagtaccgtaaaagctgcttttaacttaaactgggcagatactcaagaagtaggtaaa
ccaatctctgaaggtgttggccttccattcattttggataacgatgctaacgttgctgct
cttggcgaacgttgggtaggggcaggtgaaaataatccagatgttgttttcattactctt
ggaactggtgttggtggcggaattatcgcttcaggtgagctcgttcatggtgttgccgga
gctggtggcgaaattggccacatttgtgttgacccttatggttttgaatgtacttgtgga
aatcgcggttgcttggaaacagtaacttctgcaacaggtatcgttcgtttagctcgtaaa
ttcgctgaagaatatgaaggtgattctactattaaagcagctattgacaatggtgatgaa
gtgacttctaaagacatcttctttgcagctcaagaaggagatcacttcagcttatccgtt
gttgataaatttgcttattatctcggttttgcttgtgcaaaccttggttctactttgaac
cctgcttcaatcgtcatcggtggtggtgtttctgctgctggagaattcttacgtgaaaaa
gttgaaaaatatttcactaaatatgccttttcaactgttcgtaactcaagtaaaatcaaa
cttgctgtccttggaaatgacgctggaattatcggtgccgcaagtcttgctcttaaattt
aaaggagaataa

DBGET integrated database retrieval system