KEGG   Lactococcus lactis subsp. lactis CV56: CVCAS_2087Help
Entry
CVCAS_2087        CDS       T01964                                 

Gene name
thrC
Definition
threonine synthase (EC:4.2.3.1)
Orthology
K01733  
threonine synthase [EC:4.2.3.1]
Organism
llt  Lactococcus lactis subsp. lactis CV56
Pathway
Glycine, serine and threonine metabolism
Vitamin B6 metabolism
Metabolic pathways
Microbial metabolism in diverse environments
Biosynthesis of amino acids
Module
Threonine biosynthesis, aspartate => homoserine => threonine
Brite
KEGG Orthology (KO) [BR:llt00001]
 Metabolism
  Overview
   01230 Biosynthesis of amino acids
    CVCAS_2087 (thrC)
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    CVCAS_2087 (thrC)
  Metabolism of cofactors and vitamins
   00750 Vitamin B6 metabolism
    CVCAS_2087 (thrC)
Enzymes [BR:llt01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.3  Acting on phosphates
    4.2.3.1  threonine synthase
     CVCAS_2087 (thrC)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(2130337..2131827)
Genome map
AA seq 496 aa AA seqDB search
MVTFYQSTRDKSNKKTASQAILQGLAEDGGLFVPVDFPKVDLDFEKLKNASYQEIAELVL
KAFFDDFSADEIKSMVTKAYGEKFDSPEIAPLKRLGNHYILELFHGETIAFKDMALSILP
HLMTQAAKKNGVTNEIVILTATSGDTGKAAMAGFADVPQTKIIVFYPKGGVSHIQEQQML
TQKGENVHVVGIDGNFDQAQTAVKEMFNNKVLHDQLLKNNKQFSSANSMNIGRLIPQVAY
YIYAYAQLVKTGQITDGEEINFSVPTGNFGNILAAYYAKKLGLPVHQLICASNKNNVLTD
FFKTGLYDKNREFYVTSSPSMDILVSSNLERLIFELTDENDKVTSDLLTALSVEGHYQIS
KEMITKLQGFVADWASEDEISKEIQETFENEKYVLDPHTAVANYVYHQIQPKEKTVVVST
ASPYKFPKVVLEGLENDKTELSVNRDDFAAVKSLEKLSGIPLPKAVIGLEEAEVLHHTVI
PAAEMQKEVEKYLGLK
NT seq 1491 nt NT seq  +upstreamnt  +downstreamnt
atggtaactttttatcagtcaacacgtgataaatcaaataaaaaaacagcgtcacaagct
attttacaaggtttggcagaagatggtggactttttgttcccgttgacttcccaaaagtt
gatttagactttgaaaaattaaaaaacgcttcttatcaagaaattgctgaacttgttttg
aaagcattttttgatgatttttctgctgacgaaattaaatcaatggtgacaaaagcatac
ggagaaaaattcgatagtccggaaattgcaccgcttaaaagacttgggaatcactatatt
cttgaactttttcatggtgaaacgattgcttttaaagacatggcactctctatcttacct
catttaatgacccaagcggctaagaaaaatggtgtgactaatgaaattgttatcttgact
gcaacttctggagatacagggaaagccgcaatggccggttttgctgatgtgccccaaaca
aaaattattgttttttatcccaaaggtggtgtcagccatattcaagagcaacaaatgctg
actcaaaaaggggaaaatgttcacgttgttggaattgatggaaactttgaccaagctcaa
acagcagtaaaagaaatgtttaataacaaagttttacatgatcaacttttgaaaaataat
aaacaattttcgtcagcaaattcaatgaatattggacgtttgattccacaagttgcttat
tatatttatgcttacgcacaacttgtcaaaactggtcaaattactgacggagaagaaatt
aatttttcagttccaacagggaattttggaaatatcttagcggcttattatgctaaaaaa
ttgggcttgcccgttcatcagctcatctgtgcttcaaataaaaataatgtactgacagac
tttttcaaaacaggactttatgataaaaatcgtgaattctatgtaacaagttcaccttca
atggatattttggtctcttcaaatcttgaacgtttaatttttgaattaactgacgaaaat
gataaagtaacctcagatttactgacagccctatcagtagaagggcattatcaaatttct
aaagaaatgattactaaacttcagggatttgtggccgactgggcatcagaagatgaaatt
tcaaaagaaattcaagaaacttttgaaaatgaaaaatatgttctggaccctcatacagca
gtagcaaattatgtctatcatcaaattcaacccaaagaaaaaacagttgtggtcagcacg
gcaagtccttataagtttccaaaagttgttttagaagggcttgaaaatgataaaacagag
ctgtcagtaaatagagacgattttgctgctgttaaatcacttgaaaaattgagtgggatt
ccattaccaaaagcagtcatcggacttgaagaagcagaagttctacatcataccgttatt
ccagccgctgaaatgcaaaaagaagtagaaaaatatcttggcttaaaatga

DBGET integrated database retrieval system