KEGG   Lactococcus lactis subsp. lactis CV56: CVCAS_pA0010Help
Entry
CVCAS_pA0010      CDS       T01964                                 

Gene name
rmlC
Definition
dTDP-4-dehydrorhamnose 3,5-epimerase
Orthology
K01790  
dTDP-4-dehydrorhamnose 3,5-epimerase [EC:5.1.3.13]
Organism
llt  Lactococcus lactis subsp. lactis CV56
Pathway
Streptomycin biosynthesis
Polyketide sugar unit biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Class
Metabolism; Metabolism of terpenoids and polyketides; Polyketide sugar unit biosynthesis [PATH:llt00523]
Metabolism; Biosynthesis of other secondary metabolites; Streptomycin biosynthesis [PATH:llt00521]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
pCV56A:15368..15952
Genome map
AA seq 194 aa AA seqDB search
MKKKLDIKPLVISNSKINGLQVINSKMVTDNRGTVRELYRQSSYSETLPSSVTSWKQVNL
TRTKRGAVRGLHGEAMSKLVTVAHGSAFGVYVDTRPGSETIGKVMTVNITPGVQVFVPQG
VCNGFQSLDDDTEYLYFFDNEWNPRMSGVALTPLDADLKIDWPIQIDPGNLEQISEKDSR
APRLREILNFQKEV
NT seq 585 nt NT seq  +upstreamnt  +downstreamnt
atgaaaaaaaaattagatattaaacctttagttatttcaaattctaaaattaatggattg
caagtcattaattcaaaaatggtaactgataatcgtggaaccgttagagaactttatcgt
cagagtagctattctgaaactttacctagtagtgtgacttcgtggaagcaagtaaattta
actcgaacaaaacgaggagcagtcagaggtctccatggcgaagcgatgtctaagttagtg
acagttgcccatggttctgcctttggtgtatatgttgatacaaggccaggaagtgaaact
attggtaaagttatgactgttaatataacaccaggtgttcaagtctttgttcctcaggga
gtatgtaatggatttcagtcgcttgatgatgatactgaatatttatatttctttgacaat
gaatggaatccaagaatgtcaggagttgcattaaccccactagatgctgatttgaagatt
gactggccaattcaaatcgacccaggcaatttagaacagatatctgaaaaggactcaaga
gctccacgacttcgtgaaattcttaactttcaaaaggaggtatga

DBGET integrated database retrieval system