KEGG   Lactococcus lactis subsp. cremoris KW2: kw2_0635Help
Entry
kw2_0635          CDS       T02848                                 

Definition
4-alpha-glucanotransferase
Orthology
K00705  
4-alpha-glucanotransferase [EC:2.4.1.25]
Organism
llw  Lactococcus lactis subsp. cremoris KW2
Pathway
Starch and sucrose metabolism
Metabolic pathways
Class
Metabolism; Carbohydrate metabolism; Starch and sucrose metabolism [PATH:llw00500]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
631186..633189
Genome map
AA seq 667 aa AA seqDB search
MVTNTFSIEPYGEKAYHTGIAVPVFSLRTENSSGVGQFSDLKKLADFTYRSGMDVIQLLP
INDTTTFMDWRDSYPYRAISVFALHPLYLDIHEFWKSYTKEQQEKLLILESELNSLEKID
YERCLALKWEYAQIIYQNSAVKYQKTKAYQQFYKQNEEWLKAYACFSYLRDINKSANFLA
WGKNANYDKNLFDKLKKETSQLDLYIFVQYLLHSQLTEAVDYCHKLGIGLKGDIAIGIAH
DSVDAWTHPELFHLDKQAGAPPDVFAVNGQNWGFPTYNWEKMAEDGYDWWKKRLTAMSNY
FDAYRLDHILGFFRIWQMPENSVRGLLGQFSPALALSAEEIENNYGIPFRQWGIERFIIP
FIKDWVIDEVFGRDNRDWIIQTFLDYIGTGNYRFKAEFNNQKAIENTQMENWVREGLYKL
QENVIFLKDDENSEKYHPRIGLLSTISFREFGDDYKVRLDRLYNDYFYGRNYDFWKEKAY
EKLPALKNATKMLACGEDLGMVPNNVPDVMYHLDILRLIIERMPADERFVSSLSEVPYLS
VVTTSSHDTSPLRAWWEENHDLTQRYYNEVMGWYGEAPNYASVEIIQEIIKRNLNSNAMM
VILPIQDWLAMSDHFRKENAKSEQINIPANPYHYWNYRLHCNLEALIENQEWTDFLKNFI
KESKRAY
NT seq 2004 nt NT seq  +upstreamnt  +downstreamnt
atggtaactaacacattttcaattgaaccctatggagaaaaagcttaccataccggaata
gcagtcccagttttttctcttagaacggaaaactctagcggagtaggtcagttctcagac
cttaagaaattggccgattttacctatcgctctggcatggatgtcatccaattactacca
attaatgatacgacgacttttatggattggcgagattcctatccttatcgggcaatttcc
gtttttgctttgcatccactctatttagatattcatgaattttggaaatcttatacaaaa
gagcaacaagaaaaacttttgattttagaatcagaattaaattctttagagaagatagat
tatgaaagatgtctggcactaaagtgggaatatgcgcaaattatttatcaaaattcagcc
gtaaaatatcaaaaaaccaaggcttatcaacaattttataaacaaaatgaagaatggttg
aaggcctatgcctgtttttcctatttaagagacattaataagagtgctaattttttagct
tggggaaaaaatgcgaattatgataaaaatttatttgataaattaaaaaaagagactagc
cagttagatttatatatttttgtgcaatatcttctccattctcaacttactgaagcagta
gattattgtcataaattaggaattggtttaaaaggagacatagcgattggaattgctcac
gattctgtagatgcgtggacccatcccgaacttttccatcttgataaacaagctggtgcg
cctcctgatgtttttgccgtaaatggacaaaactggggattcccaacttataattgggaa
aagatggctgaagatggctatgattggtggaaaaaacgtctaaccgccatgtcaaattac
tttgatgcttatcgcctcgaccatattcttggattctttagaatatggcaaatgccagaa
aattcggtaagaggattgctaggtcaattttcacccgcactggctttgtcagcagaagaa
attgaaaataattatggaattccattccgacaatgggggattgagcgcttcatcatacct
ttcatcaaagattgggtgatagacgaagtttttggtcgagataatcgtgattggattatt
caaacatttttagactatattggtactggtaactatcgttttaaagcagaattcaacaac
caaaaagcgatagagaatactcaaatggagaactgggttcgcgaaggactttataaatta
caagaaaatgtaatttttttaaaggatgatgaaaatagtgaaaagtatcatccacgaatt
ggtctgttatccacaataagttttcgagaatttggtgatgactacaaagtacgattggat
cggctttacaatgactatttttatggtcgaaattatgatttttggaaagaaaaagcctat
gaaaaattgccagccttaaaaaatgcgaccaagatgttggcatgtggcgaggacttaggg
atggtgccaaataatgttccagatgtgatgtatcatcttgatatcttacgactgattatt
gaacgaatgcctgctgatgaacggtttgtcagctcattaagtgaagttccatatttatca
gtagtaaccacatctagccatgataccagccctttaagagcttggtgggaagaaaaccat
gatttaactcaacgttattacaacgaagtcatgggttggtatggagaagcgccaaactat
gcgagtgtggaaattatccaagaaataattaagagaaatttaaattctaatgccatgatg
gttatcttacctattcaagattggttagcaatgagtgaccattttagaaaagaaaatgca
aaatctgaacaaattaatattcctgcaaatccgtatcattactggaattatcggcttcat
tgtaatcttgaagcattgattgaaaatcaagaatggaccgattttctaaagaactttatt
aaagaaagcaagcgagcctattaa

DBGET integrated database retrieval system