KEGG   Lactococcus lactis subsp. cremoris KW2: kw2_1646Help
Entry
kw2_1646          CDS       T02848                                 

Definition
glycoside hydrolase GH13 family
Orthology
K01176  
alpha-amylase [EC:3.2.1.1]
Organism
llw  Lactococcus lactis subsp. cremoris KW2
Pathway
Starch and sucrose metabolism
Metabolic pathways
Class
Metabolism; Carbohydrate metabolism; Starch and sucrose metabolism [PATH:llw00500]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(1739998..1741572)
Genome map
AA seq 524 aa AA seqDB search
MKNKLLLLSVTLLATCALSACQKANSKDSSVKKAAVSQKVDTSLYRNFYEIFTSSFADSN
HDGEGDLNGVTQHLDYLNTGNKNSTTDLKVQGLWMTPIFASPSYHGYDVSNYEEINPKFG
TMTDFENLIAQAKKRGIAVILDMPFNHTATDNVWFQKALAGDKKYMAYYNWSDTAKEGYS
LASNGKYYESEFDKSMPDLNLANPEVKKEIVKITKFWLDKGVSGFRLDAVGFYFSNDDKK
TTAFTKWLTDTVKKQNPKAYLVGEVFSTASAIDDIYQSGIDSLFDFPNALQSSSSPINSA
LVLGEGSLFGQQIEAWDQEIHADNPKAIDAPFLSNHDTDRSATLLSSLAMQKMAAQTYLL
MPGNPFIYYGEELGLTGSGIDQNKRLPMQWSADGANSPKANVAVPGATETATTDGGSVAQ
QEANPNSLLNWYKKILRVKAKYPEIATARLKNISVSKDSLSVINYGKDLTIVNNFSDKES
MTVKLPKGVVGKKITDQLSGGGVQATLTDGKLTIPAYSTVILKK
NT seq 1575 nt NT seq  +upstreamnt  +downstreamnt
atgaaaaataagcttttacttctgtcagtaactttactggcgacgtgtgctttaagtgct
tgtcaaaaagcaaattcaaaagattcatcagtaaaaaaagcggctgtcagccaaaaggtt
gatacgagtttgtatcgtaatttttatgaaatatttacgagttcatttgccgattcaaat
catgatggcgaaggtgatttaaatggggtcacgcaacatttagattatctcaatacgggg
aataaaaattctacaacagatttgaaagtgcaaggactttggatgaccccaatctttgct
agtccaagctatcatggctatgatgtcagcaattacgaagaaattaatcctaagtttggc
acaatgactgattttgaaaatctgattgctcaagctaaaaaaagaggaattgctgtgatt
ttggacatgccatttaaccacacggcaactgacaatgtctggtttcaaaaagcactagct
ggcgacaagaaatatatggcttattataattggtcggacacagcaaaagagggttacagt
ctagctagcaatggaaaatactatgagtcagagtttgataaatcaatgccagacctcaat
cttgccaatcctgaggtcaaaaaagaaattgtaaaaattacgaaattttggttagacaaa
ggtgtttctggttttcgtttggacgctgtcggtttttatttctcaaatgatgataaaaaa
acgacggcctttaccaaatggctgacagatacggtcaaaaagcaaaatccaaaagcttat
ttagtgggtgaagttttttcaacggcttcggcaattgatgatatttatcagtcaggtatt
gattctttatttgactttccaaatgctttgcaatcaagttcaagtccaattaattcggct
ttagtcttaggtgagggttctttatttggtcagcaaatcgaagcttgggaccaagaaatt
catgctgacaacccgaaagccattgacgctccttttttgagtaatcatgacacagatcgg
tcagctacgcttttaagctctttagccatgcaaaaaatggctgctcaaacttaccttttg
atgccgggaaatccatttatttactacggcgaagaattggggctgacaggttctggtatt
gaccaaaacaaacgtttgccaatgcaatggtcggctgatggagcaaattcgcctaaggca
aatgttgcggttcctggtgcgactgaaactgccacaactgacggaggttcggtggctcag
caagaagccaatccaaattcgctacttaattggtacaaaaaaatcttgcgagtcaaagca
aaatatcctgagattgcgactgccaggctgaaaaatatttctgtcagtaaagatagcttg
tctgtcattaattatggaaaggatttgaccattgtcaataatttttcagataaagaaagt
atgacagtgaaactcccgaaaggagttgtcggcaaaaaaattactgaccaactttctggt
ggtggagtccaagcgacattgactgatggaaaattgacaattccagcttacagtacagtt
attttgaaaaaataa

DBGET integrated database retrieval system