KEGG   Lactococcus lactis subsp. cremoris KW2: kw2_2170Help
Entry
kw2_2170          CDS       T02848                                 

Definition
penicillin-binding protein 2A
Orthology
K12555  
penicillin-binding protein 2A [EC:2.4.1.129 2.3.2.-]
Organism
llw  Lactococcus lactis subsp. cremoris KW2
Pathway
beta-Lactam resistance
Peptidoglycan biosynthesis
Brite
KEGG Orthology (KO) [BR:llw00001]
 Metabolism
  Glycan biosynthesis and metabolism
   00550 Peptidoglycan biosynthesis
    kw2_2170
 Human Diseases
  Drug resistance
   00312 beta-Lactam resistance
    kw2_2170
Enzymes [BR:llw01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.2  Aminoacyltransferases
    2.3.2.-  
     kw2_2170
  2.4  Glycosyltransferases
   2.4.1  Hexosyltransferases
    2.4.1.129  peptidoglycan glycosyltransferase
     kw2_2170
Glycosyltransferases [BR:llw01003]
 Polysaccharide
  Bacterial polysaccharide
   kw2_2170
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(2233800..2236031)
Genome map
AA seq 743 aa AA seqDB search
MPENKNFSRRSKKETGKKSLKIPKIRPKKQKKLEEEIEKPAKTKFGKFMRPIKRFWKRYN
LTKITIIFVLVAIVATGSYLFYLAKTANVKVLQSSISAQTVIYDKDNNEAGNLYGQKGTP
VKIDQISKNITNAVVATEDRTFYENHGVNLKRFALAAVTLGRFGGGSTITQQLAKNAYLT
QEQTIDRKAREFFLALEINKHYSKDEILDMYLNNSYFGNGVWGIQDAALKYFGVPASEVT
VDEAASLAGMLKGPEIYNPLYEKGKYATDRRNTVLQNMVNAGYLEQSQADSFMKVDLQAQ
LQDNYQSKSSQYKYPSYYNAVISEAERKYGLTLQEIMNNGYKIYTGMDQNMQSGLQKTYA
DPSFFPQAADGTYAQSASVAIDPKTGAVNALVGNVNTEGSNSFTDYNYATMSKRSPGSVI
KPLIVYAPAIEAGWSIDKTVDDSPADYNGWKPTDFDNQWRGQIPMYTALANSYNIPAINT
YQAIGPKVGNALGREFGLDLNSKNDVLPTALGAGVETNPWQIAQAYQAFANGGVMNDAHL
ITKIENAAGQVVKTAKVNKKRVVSKDTADKMTQMMLGTYTNGSAWKASPKSYTLAGKTGT
NEDQDQWVVGYTPDVVMALWVGYSDGKYKLTGSSEGQTSVIFRQEASYMLPYTKGTPFTV
ENPYAQAGVAAQQPYWTQQRQYQDDIVDQEQAEANTTGNTPESSSSSTSSSSDSNGLDLG
KIGKNIGDAAKNAWDKVKGVFGN
NT seq 2232 nt NT seq  +upstreamnt  +downstreamnt
atgcctgaaaataagaatttcagtcggcgtagtaaaaaagaaacaggaaagaaaagttta
aaaattcctaaaatacgccctaaaaaacaaaaaaaacttgaagaagaaatagaaaaacca
gctaaaactaaatttggtaaatttatgagaccgataaaacgtttctggaaacgttataac
ttaacaaaaattacgattatttttgttttggtagcgatcgttgcgacaggctcatatctt
ttttacttggctaaaacagcaaatgtgaaggttctacaaagttctatttctgctcagaca
gttatttatgataaagataataatgaagctggaaatctttatggccaaaagggaactcct
gttaagattgaccaaatttctaaaaatattacgaatgctgtagtggcaacagaagataga
accttttatgaaaaccacggggttaatttgaaacgttttgctctggcggcagtaacactt
ggtcgttttgggggtggttcaacaattactcaacagttggccaaaaatgcttacttgact
caagaacaaaccattgaccgtaaggcgcgtgaatttttcttggctcttgaaattaacaaa
cactatagcaaagatgagattttagatatgtatttgaataactcttactttggtaatggg
gtttggggaattcaagatgcagccttgaaatattttggtgttccagccagtgaagtaact
gttgatgaagcagccagtcttgccggaatgctaaaaggtcctgaaatttataatccttta
tatgaaaagggaaaatatgccactgaccgtcgcaataccgttttacaaaatatggttaat
gctggctatcttgagcaatcacaagcagacagctttatgaaggttgatttacaagctcaa
ttgcaagataattatcaatctaaaagtagtcaatacaaatatccaagctattataatgcg
gtaatttctgaggctgaacgtaagtatggtttaaccttacaagaaattatgaataatggc
tataaaatttatacgggaatggatcaaaatatgcagtcaggtttacaaaaaacctatgcg
gatccaagcttcttcccacaagcagcagatggaacctatgcccagtcagcatcggtggca
attgatccaaaaacaggagctgttaatgctctcgtgggtaatgttaatacagaaggttct
aatagttttactgattataactatgcgacaatgtctaaacgttctcccggttcggtcatc
aaaccattgattgtctatgctcctgcaattgaagcgggttggtcaattgacaaaacagtt
gatgactctccggctgattataatggttggaaaccaacggactttgataatcaatggcga
ggacaaattccgatgtatacggctttagccaattcatataatattccagccataaatacc
tatcaagccattggtccaaaagttggaaatgctttgggacgtgaatttggtttggattta
aatagtaaaaatgatgttttaccaacggctcttggcgcaggagttgaaacaaatccatgg
caaattgctcaggcttatcaagcttttgccaatggtggagtaatgaatgatgcgcatctc
attactaaaattgaaaatgcggctggtcaagtcgttaaaacggcaaaagtaaacaaaaaa
cgtgtcgttagtaaagatactgccgataaaatgactcaaatgatgttagggacttacact
aatggttctgcttggaaagcttcacctaaatcttatactttggcaggtaagacagggact
aacgaagaccaagaccagtgggtagtcggttatactccagatgttgtgatggcgctttgg
gttggttattctgatggtaaatataaattgacaggttcatcagaaggacaaacgtcagta
attttccgtcaggaagcaagttatatgttgccttacaccaaaggaacacctttcacagtt
gaaaacccttatgctcaggcaggcgttgcggctcaacaaccttattggactcaacaaaga
caatatcaagatgatattgtagaccaagaacaggcagaagcgaatacgactggaaatact
ccagaaagctctagttctagcacttcatcatcttctgattccaatggtttggacctaggt
aaaattggtaaaaatattggtgatgcagctaaaaatgcttgggataaagttaaaggggtt
tttggcaactaa

DBGET integrated database retrieval system