KEGG   Lactococcus lactis subsp. cremoris KW2: kw2_2214Help
Entry
kw2_2214          CDS       T02848                                 

Definition
bifunctional acetaldehyde-CoA/alcohol dehydrogenase
Orthology
K04072  
acetaldehyde dehydrogenase / alcohol dehydrogenase [EC:1.2.1.10 1.1.1.1]
Organism
llw  Lactococcus lactis subsp. cremoris KW2
Pathway
Glycolysis / Gluconeogenesis
Fatty acid degradation
Tyrosine metabolism
Pyruvate metabolism
Chloroalkane and chloroalkene degradation
Naphthalene degradation
Butanoate metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Degradation of aromatic compounds
Brite
KEGG Orthology (KO) [BR:llw00001]
 Metabolism
  Overview
   01220 Degradation of aromatic compounds
    kw2_2214
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    kw2_2214
   00620 Pyruvate metabolism
    kw2_2214
   00650 Butanoate metabolism
    kw2_2214
  Lipid metabolism
   00071 Fatty acid degradation
    kw2_2214
  Amino acid metabolism
   00350 Tyrosine metabolism
    kw2_2214
  Xenobiotics biodegradation and metabolism
   00625 Chloroalkane and chloroalkene degradation
    kw2_2214
   00626 Naphthalene degradation
    kw2_2214
Enzymes [BR:llw01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.1  alcohol dehydrogenase
     kw2_2214
  1.2  Acting on the aldehyde or oxo group of donors
   1.2.1  With NAD+ or NADP+ as acceptor
    1.2.1.10  acetaldehyde dehydrogenase (acetylating)
     kw2_2214
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
2282653..2285364
Genome map
AA seq 903 aa AA seqDB search
MATKKAAPAAKKVLSAEEKAAKFQEAVAYTDQLVKKAQAAVLKFEGYTQTQVDTIVAAMA
LAASKHSLELAHEAVNETGRGVVEDKDTKNHFASESVYNAIKNDKTVGVIAENKVAGSVE
IASPLGVLAGIVPTTNPTSTAIFKSLLAAKTRNAIVFAFHPQAQKCSSHAAKIVYDAAIE
AGAPEDFIQWIEVPSLDMTTALIQNRGIATILATGGPGMVNAALKSGNPSLGVGAGNGAV
YVDATANIDRAVEDLLLSKRFDNGMICATENSAVIDASIYDEFVAKMQAQGAYMVPKKDY
KAIESFVFVERAGEGFGVTGPVAGRSGQWIAEQAGVKVPKDKDVLLFELDKKNIGEALSS
EKLSPLLSIYKSETREEGIEIVRSLLAYQGAGHNAAIQIGAMDDPFVKEYGIKVEASRIL
VNQPDSIGGVGDIYTDAMRPSLTLGTGSWGKNSLSHNLSTYDLLNVKTVAKRRNRPQWVR
LPKEIYYEKNAISYLQELPHVHKAFIVADPGMVKFGFVDKVLEQLAIRPTQVETSIYGSV
QPDPTLSEAIAIARQMKQFEPDTVICLGGGSALDAGKIGRLIYEYDARGEADLSDDASLK
ELFQELAQKFVDIRKRIIKFYHPHKAQMVAIPTTSGTGSEVTPFAVITDDETHVKYPLAD
YQLTPQVAIVDPEFVMTVPKRTVSWSGIDAMSHALESYVSVMSSDYTKPISLQAIKLIFE
NLTESYHYDPAHPTKEGQKARENMHNAATLAGMAFANAFLGINHSLAHKIGGEFGLPHGL
AIAIAMPHVIKFNAVTGNVKRTPYPRYETYRAQEDYAEISRFMGFAGKEDSDEKAVKALV
AELKKLTDSIDINITLSGNGVDKAHLERELDKLADLVYDDQCTPANPRQPRIDEIKKLLL
DQY
NT seq 2712 nt NT seq  +upstreamnt  +downstreamnt
atggcaactaaaaaagccgctccagctgcaaagaaagttttaagcgctgaagaaaaagcc
gcaaaattccaagaagctgtcgcttatactgatcaattagtcaaaaaagctcaagctgca
gttcttaaatttgaaggatacacacaaactcaagttgatactattgttgctgcaatggct
cttgcagcaagcaaacattctctggaactcgctcacgaagccgttaatgaaactggccgc
ggagttgttgaggacaaagatacaaaaaaccattttgcttctgaatctgtttataatgca
atcaaaaatgataaaacagttggcgttatcgctgaaaacaaagttgctggttctgttgaa
atcgcaagcccccttggagtacttgctggtattgtcccaacaactaatccaacatcaaca
gccatctttaaatctttattggctgcaaagacacgtaatgctattgtctttgcctttcac
ccacaagcacaaaaatgctcaagccatgcagctaaaattgtttatgatgctgctattgaa
gcaggtgcacctgaagacttcattcaatggattgaagtacccagtcttgatatgacgact
gctttgattcaaaatagaggaattgctacaattcttgcaactggtggtccaggtatggtc
aatgccgcgcttaagtctggtaatccttcacttggtgtaggtgctggtaacggtgcagtg
tacgttgatgcaactgcaaatatcgatcgtgctgttgaagatctcttgctttcaaaacgt
tttgataacggaatgatttgtgcgactgaaaactctgcagttattgatgcatcaatctat
gatgaatttgtcgctaaaatgcaagcacaaggcgcttatatggttcctaaaaaagattac
aaggcaattgaaagttttgttttcgttgaacgtgctggtgaaggttttggtgtaactggt
cctgttgctggtcgttctggtcaatggattgctgaacaagctggtgttaaagtccctaaa
gataaagatgttcttctttttgaacttgataagaaaaatattggggaagctctttcttct
gaaaaactttctcctttgctttcaatctacaaatcagaaacacgtgaagaaggaattgaa
attgtccgtagcttacttgcttaccaaggagctggtcacaacgctgccattcaaatcggt
gcaatggacgacccatttgtcaaagaatacggaattaaagtcgaagcttctcgtatcctc
gttaaccaacctgactctatcggtggggtcggagatatttatactgatgcaatgcgtcca
tcattgacgctcggaactggttcatgggggaaaaattcactttcacacaatttgagtaca
tacgatctattgaatgttaaaacagtggctaaacgtcgtaatcgccctcaatgggttcgt
ttgccaaaagaaatttactacgaaaaaaatgcaatttcttacttacaagaattgccacac
gtccacaaagctttcattgttgccgaccctggtatggttaaattcggtttcgttgataaa
gttttggaacaacttgctatccgcccaactcaagttgaaacaagcatttatggctcagtc
caacctgacccaactttgagcgaagccattgcaatcgctcgtcaaatgaaacaatttgaa
cctgacactgtcatctgtcttggtggtggttctgcccttgatgctggtaagattggacgt
ttgatttatgaatatgatgctcgtggtgaggctgacctttccgatgacgcaagtttgaaa
gagctcttccaagagttagctcaaaaatttgttgatattcgtaaacgtattatcaaattc
taccacccacacaaagcacaaatggttgctatccctactacttctggtactggttctgaa
gtgactccatttgcggttatcactgatgatgaaactcacgttaaatatccacttgctgac
tatcaattgacacctcaagttgccattgttgaccctgagtttgttatgactgtaccaaaa
cgtactgtttcttggtctgggattgatgctatgtcacacgcgcttgaatcttatgtttct
gtcatgtcttctgactatacaaaaccaatatcacttcaagccatcaaacttatctttgaa
aacttgactgagtcttatcactatgacccagctcatccaaccaaagaaggtcaaaaagct
cgcgaaaacatgcacaatgctgcaacactcgctggtatggccttcgccaatgctttcctt
ggaattaaccactcacttgctcataaaattggtggtgaatttggacttccacatggtctc
gccattgccatcgctatgccacacgtcattaaatttaacgcagtgacaggaaacgtgaaa
cgtacgccttatccacgttatgaaacttatcgtgcgcaagaagactacgctgaaatttca
cgcttcatgggatttgctggcaaagaagattcagatgaaaaagcggtcaaagccttggtt
gctgaacttaagaaattgactgacagcattgacattaacatcactctgtcaggaaatggt
gtcgataaagcacatcttgaacgtgaacttgataaattggctgaccttgtttatgatgac
caatgtactcctgctaatccacgtcaacctcgtattgacgagattaagaagttgttgttg
gatcaatactaa

DBGET integrated database retrieval system