KEGG   Leishmania major: LMJF_06_0860Help
Entry
LMJF_06_0860      CDS       T01014                                 

Gene name
DHFR-TS
Definition
dihydrofolate reductase-thymidylate synthase
Orthology
K13998  
dihydrofolate reductase / thymidylate synthase [EC:1.5.1.3 2.1.1.45]
Organism
lma  Leishmania major
Pathway
Pyrimidine metabolism
One carbon pool by folate
Folate biosynthesis
Metabolic pathways
Class
Metabolism; Nucleotide metabolism; Pyrimidine metabolism [PATH:lma00240]
Metabolism; Metabolism of cofactors and vitamins; Folate biosynthesis [PATH:lma00790]
Metabolism; Metabolism of cofactors and vitamins; One carbon pool by folate [PATH:lma00670]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
GeneDB: 
UniProt: 
Position
6:373501..375063
Genome map
AA seq 520 aa AA seqDB search
MSRAAARFKIPMPETKADFAFPSLRAFSIVVALDMQHGIGDGESIPWRVPEDMTFFKNQT
TLLRNKKPPTEKKRNAVVMGRKTWESVPVKFRPLKGRLNIVLSSKATVEELLAPLPEGQR
AAAAQDVVVVNGGLAEALRLLARPLYCSSIETAYCVGGAQVYADAMLSPCIEKLQEVYLT
RIYATAPACTRFFPFPPENAATAWDLASSQGRRKSEAEGLEFEICKYVPRNHEERQYLEL
IDRIMKTGIVKEDRTGVGTISLFGAQMRFSLRDNRLPLLTTKRVFWRGVCEELLWFLRGE
TSAQLLADKDIHIWDGNGSREFLDSRGLTENKEMDLGPVYGFQWRHFGADYKGFEANYDG
EGVDQIKLIVETIKTNPNDRRLLVTAWNPCALQKMALPPCHLLAQFYVNTDTSELSCMLY
QRSCDMGLGVPFNIASYALLTILIAKATGLRPGELVHTLGDAHVYRNHVDALKAQLERVP
HAFPTLIFKEERQYLEDYELTDMEVIDYVPHPAIKMEMAV
NT seq 1563 nt NT seq  +upstreamnt  +downstreamnt
atgtccagggcagctgcgaggtttaagattccgatgccggagacgaaggcagactttgct
ttcccctccctgcgcgccttctccatcgtcgtggccctcgatatgcagcacggcatcggc
gacggcgagtcgatcccgtggcgggtgccggaggacatgacgttcttcaagaaccagacg
acgctgctgcgcaacaagaagccgccgacggagaagaagcgcaacgccgtcgtgatgggc
cgcaagacttgggagagcgtcccggtaaagttccgaccactcaagggacggctgaacatc
gtgttatcctcgaaggccaccgtcgaggagcttctggcgccgctgccggagggacagcgc
gcggcggcggcgcaggatgtggtggtggtgaacggcggtctggccgaggcgctccgcctc
ctcgcacgcccgctgtactgcagctccatcgagacagcgtattgcgtcggtggtgcgcag
gtttacgcggacgccatgctgtcgccgtgcatcgagaaactgcaggaagtgtacctgacc
cgcatctacgcgacggcgcctgcgtgtacgcgcttctttccgtttccgcccgagaacgcg
gccacggcgtgggacctggcgtcgtctcagggacgccgcaagagcgaggcggagggcctc
gagttcgagatctgcaagtacgtgccgcgcaaccacgaggagcggcagtaccttgagctg
attgaccgcatcatgaagacggggatcgtgaaggaggaccgcaccggcgtgggcaccatc
agcctcttcggcgcccagatgcgcttctccctacgcgacaaccgcctgccgctgctgacg
acgaagcgtgtcttctggcgcggcgtgtgcgaggagctgctgtggttcctgcgcggggag
acgagtgcgcagctgctggcagacaaggacattcacatctgggacggcaacggttcgcgc
gagtttctcgacagccgcggcttgacagagaataaggagatggacctcggccctgtctac
ggcttccagtggcgccacttcggggcagattacaaggggtttgaagcgaactacgacggc
gaaggggtggaccagatcaagctcatcgtggagaccatcaagacgaacccgaacgaccgc
cgcctcctagtcactgcctggaacccgtgcgcgctgcaaaagatggcgctgccgccgtgc
cacttgcttgctcagttctacgtgaacacagacacgagcgagctatcctgcatgttgtac
cagcgctcgtgtgacatgggtcttggcgtccccttcaacattgcctcctacgcgctgctc
accatcctcattgccaaggcgacgggtctgcggcctggtgagcttgtgcacaccctcggc
gacgcccacgtctaccgcaaccacgttgatgccctcaaggcgcagctcgagcgagtcccg
cacgcgttcccgaccctcatcttcaaggaggagcggcagtacctcgaggactacgagttg
acggacatggaggtgatcgactacgttccacacccggcgatcaagatggagatggccgta
tag

DBGET integrated database retrieval system