KEGG   Leishmania major: LMJF_06_0860Help
Entry
LMJF_06_0860      CDS       T01014                                 

Gene name
DHFR-TS
Definition
dihydrofolate reductase-thymidylate synthase
Orthology
K13998  
dihydrofolate reductase / thymidylate synthase [EC:1.5.1.3 2.1.1.45]
Organism
lma  Leishmania major
Pathway
Pyrimidine metabolism
One carbon pool by folate
Folate biosynthesis
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:lma00001]
 Metabolism
  Nucleotide metabolism
   00240 Pyrimidine metabolism
    LMJF_06_0860 (DHFR-TS)
  Metabolism of cofactors and vitamins
   00790 Folate biosynthesis
    LMJF_06_0860 (DHFR-TS)
   00670 One carbon pool by folate
    LMJF_06_0860 (DHFR-TS)
Enzymes [BR:lma01000]
 1. Oxidoreductases
  1.5  Acting on the CH-NH group of donors
   1.5.1  With NAD+ or NADP+ as acceptor
    1.5.1.3  dihydrofolate reductase
     LMJF_06_0860 (DHFR-TS)
 2. Transferases
  2.1  Transferring one-carbon groups
   2.1.1  Methyltransferases
    2.1.1.45  thymidylate synthase
     LMJF_06_0860 (DHFR-TS)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
GeneDB: 
UniProt: 
Position
6:373501..375063
Genome map
AA seq 520 aa AA seqDB search
MSRAAARFKIPMPETKADFAFPSLRAFSIVVALDMQHGIGDGESIPWRVPEDMTFFKNQT
TLLRNKKPPTEKKRNAVVMGRKTWESVPVKFRPLKGRLNIVLSSKATVEELLAPLPEGQR
AAAAQDVVVVNGGLAEALRLLARPLYCSSIETAYCVGGAQVYADAMLSPCIEKLQEVYLT
RIYATAPACTRFFPFPPENAATAWDLASSQGRRKSEAEGLEFEICKYVPRNHEERQYLEL
IDRIMKTGIVKEDRTGVGTISLFGAQMRFSLRDNRLPLLTTKRVFWRGVCEELLWFLRGE
TSAQLLADKDIHIWDGNGSREFLDSRGLTENKEMDLGPVYGFQWRHFGADYKGFEANYDG
EGVDQIKLIVETIKTNPNDRRLLVTAWNPCALQKMALPPCHLLAQFYVNTDTSELSCMLY
QRSCDMGLGVPFNIASYALLTILIAKATGLRPGELVHTLGDAHVYRNHVDALKAQLERVP
HAFPTLIFKEERQYLEDYELTDMEVIDYVPHPAIKMEMAV
NT seq 1563 nt NT seq  +upstreamnt  +downstreamnt
atgtccagggcagctgcgaggtttaagattccgatgccggagacgaaggcagactttgct
ttcccctccctgcgcgccttctccatcgtcgtggccctcgatatgcagcacggcatcggc
gacggcgagtcgatcccgtggcgggtgccggaggacatgacgttcttcaagaaccagacg
acgctgctgcgcaacaagaagccgccgacggagaagaagcgcaacgccgtcgtgatgggc
cgcaagacttgggagagcgtcccggtaaagttccgaccactcaagggacggctgaacatc
gtgttatcctcgaaggccaccgtcgaggagcttctggcgccgctgccggagggacagcgc
gcggcggcggcgcaggatgtggtggtggtgaacggcggtctggccgaggcgctccgcctc
ctcgcacgcccgctgtactgcagctccatcgagacagcgtattgcgtcggtggtgcgcag
gtttacgcggacgccatgctgtcgccgtgcatcgagaaactgcaggaagtgtacctgacc
cgcatctacgcgacggcgcctgcgtgtacgcgcttctttccgtttccgcccgagaacgcg
gccacggcgtgggacctggcgtcgtctcagggacgccgcaagagcgaggcggagggcctc
gagttcgagatctgcaagtacgtgccgcgcaaccacgaggagcggcagtaccttgagctg
attgaccgcatcatgaagacggggatcgtgaaggaggaccgcaccggcgtgggcaccatc
agcctcttcggcgcccagatgcgcttctccctacgcgacaaccgcctgccgctgctgacg
acgaagcgtgtcttctggcgcggcgtgtgcgaggagctgctgtggttcctgcgcggggag
acgagtgcgcagctgctggcagacaaggacattcacatctgggacggcaacggttcgcgc
gagtttctcgacagccgcggcttgacagagaataaggagatggacctcggccctgtctac
ggcttccagtggcgccacttcggggcagattacaaggggtttgaagcgaactacgacggc
gaaggggtggaccagatcaagctcatcgtggagaccatcaagacgaacccgaacgaccgc
cgcctcctagtcactgcctggaacccgtgcgcgctgcaaaagatggcgctgccgccgtgc
cacttgcttgctcagttctacgtgaacacagacacgagcgagctatcctgcatgttgtac
cagcgctcgtgtgacatgggtcttggcgtccccttcaacattgcctcctacgcgctgctc
accatcctcattgccaaggcgacgggtctgcggcctggtgagcttgtgcacaccctcggc
gacgcccacgtctaccgcaaccacgttgatgccctcaaggcgcagctcgagcgagtcccg
cacgcgttcccgaccctcatcttcaaggaggagcggcagtacctcgaggactacgagttg
acggacatggaggtgatcgactacgttccacacccggcgatcaagatggagatggccgta
tag

DBGET integrated database retrieval system