KEGG   Leishmania major: LMJF_06_1050Help
Entry
LMJF_06_1050      CDS       T01014                                 

Gene name
PDI-1
Definition
protein disulfide isomerase
Orthology
K01829  
protein disulfide-isomerase [EC:5.3.4.1]
Organism
lma  Leishmania major
Brite
Enzymes [BR:lma01000]
 5. Isomerases
  5.3  Intramolecular oxidoreductases
   5.3.4  Transposing S-S bonds
    5.3.4.1  protein disulfide-isomerase
     LMJF_06_1050 (PDI-1)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
GeneDB: 
UniProt: 
Position
6:440536..440937
Genome map
AA seq 133 aa AA seqDB search
MLLVRKTLAVLLAVALLVVCAKAEIVELNPANFHKVVKDPSKNVFVMFYAPWCGHCNNMK
PMWLELADKYPTAEDVIIARIDASEYRGIAKEFDIRGFPTLKFFSKRDKSGEIEYDGPRE
LSAFVAYVATNKQ
NT seq 402 nt NT seq  +upstreamnt  +downstreamnt
atgttgctcgtccggaagacactcgccgtcctgctggcggtcgccctccttgtcgtctgc
gcgaaggcggagattgtcgagctcaacccggcgaactttcacaaagttgtgaaggacccg
tccaagaacgtcttcgtcatgttctacgccccgtggtgtggccactgcaacaacatgaag
ccgatgtggctggagctggcggacaagtaccccaccgcggaggacgtcatcatcgcccgc
atcgacgccagcgagtaccgcggcatcgcgaaggagttcgacatccgcggcttcccgaca
ctgaagttcttctccaagagggacaaatcaggtgaaatcgagtatgatggcccgcgcgag
ctctccgccttcgtggcgtacgtggcgaccaacaagcagtga

DBGET integrated database retrieval system