KEGG   Leishmania major: LMJF_07_0730Help
Entry
LMJF_07_0730      CDS       T01014                                 

Definition
malonyl-coa decarboxylase-like protein
Orthology
K01578  
malonyl-CoA decarboxylase [EC:4.1.1.9]
Organism
lma  Leishmania major
Pathway
beta-Alanine metabolism
Propanoate metabolism
Metabolic pathways
Peroxisome
Class
Metabolism; Carbohydrate metabolism; Propanoate metabolism [PATH:lma00640]
Metabolism; Metabolism of other amino acids; beta-Alanine metabolism [PATH:lma00410]
Cellular Processes; Transport and catabolism; Peroxisome [PATH:lma04146]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
GeneDB: 
UniProt: 
Position
7:335864..338245
Genome map
AA seq 793 aa AA seqDB search
MRCVYRPASGTSGSAAATASSGTTLSAGTLAYALRHFSAPTRLWRSEPPPPPLPPLPGAG
ATVSEERVARWCRRLWDLTRKSTGSVASAHLTPQLQLAAHRAAAALLSSSSSSPFTAPPQ
IDDDGEVTGEVVLSSLRRAIRSDQGRIPGVIVESVWAAFDVLVPPIVQENVTEDSITPAT
GDNFFMFISTLNELNFDLHAVAKASTQLTAKVDAYVGLLRQAEAHETQRATTAEARGPAQ
VAIDGCELMEQLMKAKGEVVQCCFEARNAGSPLYYTWLWHTAAMPDGLRRLMHFRKLTHF
FESLCKRHIKHLTEQQQQQWQSMLSSSAPATGESAGTLPSAAAASATEKSRCAGELSKWR
SRLIEVGLIDGAMSLLLNDLFSKEYLVMEELTWLLTPPSMLDQIMRAESVHPFVRGLEDM
RHRLQPAHHRHLFAFLHPAVVEEPLIAVQVALTHGIASSVDQILGRPTPLSDPANTSKAA
LYFRHALESSAAVDCAGAAEDGNVNTAIFYSINSAQSALRGMDMGNRLIKRVVQEVEGNI
NARRQARSLTPIHTFSTLSPIPLYVKWLADEVAALAAAAATATAMAASGIFGKQLSTTEE
DTRYLGPLREAIAGYVLRHPDVLPAEARAVMSAAATSSRGNHTAANVAALQYLVRLLQDA
SSPPSFPRDGLATFAAGSTSTQRHQQPWWADHTLTMALEAPLLHSVATYLCTVKRSGDGR
IRDPVGNFHVSNGATVYRLNFLANTTPKASRESACIMVNYWYDLPTVSANAARYEVSRTV
PLGEPIKTLLGDM
NT seq 2382 nt NT seq  +upstreamnt  +downstreamnt
atgcgctgtgtttatcggcctgccagcggcacgagtggttctgcagcagccactgctagc
agcggcactaccctttccgccggcaccttggcgtacgccttgcggcacttcagtgcgcct
acgcgtctgtggcggtcggaaccaccgccaccaccactcccgccactgccgggggcaggc
gccacggtgagcgaggagcgtgtcgcacgatggtgtcggcggctgtgggacctcacgcgc
aagtccactggcagcgtggcctctgcccatctcaccccacagcttcaactcgccgcccac
agagcagcagcagcactgctatcatcatcgtcgtcgtcgcccttcaccgcgccaccgcag
attgacgacgatggggaggtgacgggcgaggtggtgctctctagcctgcgccgcgccatc
cgtagcgatcaaggccgcatccctggcgtcattgtggagagcgtgtgggccgccttcgac
gtgctcgtgccgcccatcgtccaggaaaacgtcacagaggatagcatcacacccgcgacg
ggggataacttctttatgttcatctcgaccttgaacgagctcaatttcgacctgcacgcg
gtcgcaaaggcaagcacgcagctgacggcgaaggtggacgcctacgtgggcctgctgcgg
caggcggaggctcacgaaacgcagcgagcgacaacagcagaggcccgtggtcctgcgcag
gtcgctatcgacggatgcgagctcatggagcagctcatgaaggctaagggggaggtcgtg
cagtgctgctttgaggcccgcaacgctggctctcctctctactacacgtggttgtggcac
acggccgccatgccggacggcctgcggcggctcatgcattttcgaaagctgacccatttc
ttcgagagcttgtgcaagcgacacatcaaacatctcacggagcagcagcagcagcagtgg
cagagcatgctgtcttcttcggcgcctgctactggcgagtcagcggggacgttgccgtca
gcagcagccgcaagcgccacggagaaaagtcggtgcgccggcgagctctccaagtggcgt
agtcgtctgatcgaggtaggcctaatcgatggtgccatgtcgcttctcttgaacgatctg
ttctccaaggagtacttggtgatggaggagctgacgtggctcttgacgccgccgtcgatg
ctggaccagatcatgcgtgctgagtctgtccatcccttcgtccgtggacttgaagacatg
cgccatcgcctgcagccggctcaccaccgccacttgttcgcctttctgcaccccgccgtt
gtcgaggagccgctcatcgccgtgcaggtggccttgacgcacggcattgccagctctgtg
gatcagatcttgggtcgccctacgccgctgtcagacccggcgaacacgtcgaaggcggct
ctctacttccgccacgcactggaatcctcggcggcggttgactgcgccggtgcggcggaa
gatggcaacgtgaacaccgccatcttctacagcatcaactctgcccaaagtgcgttgcgt
ggcatggacatgggtaaccgcctcatcaagcgcgtcgtgcaggaggtggagggcaacatt
aacgctcggcggcaggcgcgcagcttgactcccatccacaccttcagcaccctctcaccc
atcccgctctacgtcaagtggctggctgatgaagtggctgcgctggcggctgccgctgcg
acagctaccgcgatggcagcgagcggcatctttggcaagcagctctccacaaccgaggaa
gatacacgctacttggggccgcttcgcgaggcgattgccggctacgtcctgcggcacccc
gatgtcctaccggcggaggcgcgtgcggtgatgtcagcggcggccacaagcagtcgcggc
aaccacacggccgcaaacgtagcggcactgcagtacctcgtgcgtctcctccaagacgca
tcgtcgcccccctcgtttccgcgcgatggtcttgccacattcgccgcgggcagcacctcg
acacagcggcatcagcagccatggtgggcggaccatacgctcacgatggccctcgaggcg
cccctgttgcactccgttgccacgtacctgtgcaccgtgaagcgtagtggtgacggccgc
attcgcgacccagtcggcaactttcacgtgtctaacggcgccactgtttatcgactaaac
ttcctcgcgaacacgaccccgaaggccagtcgtgagagcgcctgcatcatggtgaactac
tggtacgacctgccaacggtctcagccaacgccgcgcggtacgaggtgagccgcaccgtg
cccctcggtgagccgatcaagacgctgctgggggacatgtag

DBGET integrated database retrieval system