KEGG   Leishmania major: LMJF_09_0400Help
Entry
LMJF_09_0400      CDS       T01014                                 

Definition
putative protein kinase
Orthology
K08287  
dual-specificity kinase [EC:2.7.12.1]
Organism
lma  Leishmania major
Brite
Enzymes [BR:lma01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.12  Dual-specificity kinases (those acting on Ser/Thr and Tyr residues)
    2.7.12.1  dual-specificity kinase
     LMJF_09_0400
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
GeneDB: 
UniProt: 
Position
9:164219..165496
Genome map
AA seq 425 aa AA seqDB search
MKHMSRSKSDARRSGSKRTFDEATVTDNVQQRRHDGTAVPNTAPNQVVEVVAPPPKKKKV
TYALPHQNMEEGHFYVVLGEDIDVSTQRFKILSLLGEGTFGKVVESWDRKRKEYCAVKIV
RNVPKYTRDAKIEIQFMEKVRQADPADRFPLMKIQRYFQNDSGHMCIVMPKYGPCLLDWI
MKHGPFSHRHLAQIVFQTGVALDYFHSELHLMHTDLKPENILMETSDTTVDPATNRHLPP
DPCRVRICDLGGCCDERHSRTAIVSTRHYRSPEVILGLGWMYSTDMWSMGCIIYELYTGK
LLYDTHDNAEHLHLMEKTLGRLPSEWAARCGTEEARLLYNSAGQLRPCTDPKHLARIARA
RTVRDVIRDDLLCDLIYGLLHYDRQKRLNARQMTTHPYVLKYYPEARQAPSHPDNRSMLR
PPPIM
NT seq 1278 nt NT seq  +upstreamnt  +downstreamnt
atgaagcacatgtcgcgcagcaagagcgacgcgcggcgatcgggtagcaagcgcaccttc
gatgaagccaccgtgaccgacaacgtgcagcaacgccgccacgatggcacggcggtgccg
aacaccgcaccgaaccaggtggtggaggtggtggcgccgccgcccaagaaaaagaaggtg
acgtacgcgctgccgcaccagaacatggaggagggccacttctacgtggtgctcggcgag
gacatcgacgtgtcgacgcagcgcttcaagatcctgtcgctgctcggcgagggcaccttc
ggcaaggtggtggagtcgtgggaccgcaagcgcaaggagtactgcgcggtgaagatcgtg
cgcaacgtgcccaagtacacgcgcgacgccaagatcgagatccagttcatggagaaggtg
cgccaggcggaccctgccgaccgcttcccgctgatgaagatccagcgctatttccagaac
gacagcggccacatgtgcattgtcatgcccaagtacggtccctgcctgctggactggatc
atgaagcacggccccttcagccaccgccacctcgcgcagatcgtcttccagaccggcgtc
gccctcgactacttccacagcgagctgcacctcatgcacacagacctcaagcccgagaac
atcctcatggagaccagcgacaccaccgtcgaccccgccaccaaccgccacctgccgccc
gacccgtgtcgcgtccgcatctgcgacctcggcggctgctgcgacgagcgccacagccgc
accgccatcgtctccacgcgccactaccgcagccccgaggtcatcctcggcctcggctgg
atgtactccaccgacatgtggtccatgggctgcatcatctacgagctctacaccggcaag
ctgctctacgacacgcacgacaacgccgagcacctgcacctcatggagaagacgctcggc
cgcctaccgtccgagtgggccgcgcgctgcggcacggaggaggcgcgtctgctgtacaac
tccgccggccagctgcgcccctgcaccgaccccaagcacctcgcccgcatcgcgcgcgcg
cggaccgtgcgcgacgtcatccgcgacgacctgctgtgcgacctcatctacggcctgctg
cactacgaccgccagaagcgcctcaacgcgcgccagatgaccacgcacccctacgtgctc
aaatactaccccgaggcgcggcaggcgcccagccaccccgacaaccgctccatgctgcgc
ccgccaccgatcatgtag

DBGET integrated database retrieval system