KEGG   Leishmania major: LMJF_13_1060Help
Entry
LMJF_13_1060      CDS       T01014                                 

Definition
putative NADH-cytochrome b5 reductase
Orthology
K00326  
cytochrome-b5 reductase [EC:1.6.2.2]
Organism
lma  Leishmania major
Pathway
Amino sugar and nucleotide sugar metabolism
Biosynthesis of secondary metabolites
Class
Metabolism; Carbohydrate metabolism; Amino sugar and nucleotide sugar metabolism [PATH:lma00520]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
GeneDB: 
UniProt: 
Position
13:complement(362615..363541)
Genome map
AA seq 308 aa AA seqDB search
MVGVLVIIAFGMAAFFAFMFTRTTKVAMDPTMFKHFKLIKRTEVTHDTFIFRFALENETQ
TLGLPIGQHIVLRADCTTAGKTETVTHSYTPISSDDEKGYVDFMIKVYFAGVHPSFPHGG
RMSQHMYHMKLGDKIEMRGPQGKFIYLGNGTSRIHKPGKGIVTEKVDAYAAIAGGTGITP
ILQIIHAIKKNKEDPTKVFLVYGNQTERDILLRKELDEAAANDSRFHVWYTVDREATPEW
KYDIGYVREEMFRKHLPVPDMLGNDSVPQNVGIKKVMALMCGPPPMVQMAIKPNLERIGY
TADNMFSF
NT seq 927 nt NT seq  +upstreamnt  +downstreamnt
atggtcggcgttctcgtcatcatcgccttcggcatggcggccttctttgcgttcatgttt
acgcgcacgacgaaggtggccatggacccgaccatgttcaagcactttaagctgatcaag
cgcaccgaggtgacccatgacaccttcatcttccgcttcgccctcgagaacgagacgcag
acgctcggactgccgattgggcagcacattgtgctccgcgccgactgcacgacggctggc
aagacggagacagtcacgcactcctacacacccatctccagtgacgacgagaagggctac
gtagacttcatgatcaaggtgtactttgccggcgtgcaccccagcttcccgcatggcggc
cggatgtcgcagcacatgtatcacatgaagcttggcgacaagatagagatgcgtggacca
cagggtaagtttatctacctgggcaacggcacctcgcgcatccacaaaccgggcaagggc
atcgtcacggagaaagtggacgcctatgcggccattgccggcggcactggcatcaccccg
attctgcagatcatccacgccattaagaagaataaggaggaccctacgaaggtgttcctt
gtgtatggcaaccagacggagcgtgacatcttgctgcgcaaggagctggacgaggcggcc
gccaacgacagccgctttcacgtatggtacaccgtcgaccgcgaggcgacgccagagtgg
aaatacgatattggctacgtccgcgaggagatgttccgcaagcacctgcccgtgcccgac
atgctcggcaacgacagcgtgccgcagaacgtcgggatcaagaaggtcatggcgctcatg
tgcggcccgccgccgatggtccagatggcgatcaagccgaacctagagcgcatcggctac
actgccgataacatgttcagcttctaa

DBGET integrated database retrieval system