KEGG   Leishmania major: LMJF_14_0350Help
Entry
LMJF_14_0350      CDS       T01014                                 

Definition
putative threonine synthase
Orthology
K01733  
threonine synthase [EC:4.2.3.1]
Organism
lma  Leishmania major
Pathway
Glycine, serine and threonine metabolism
Vitamin B6 metabolism
Metabolic pathways
Biosynthesis of amino acids
Brite
KEGG Orthology (KO) [BR:lma00001]
 Metabolism
  Overview
   01230 Biosynthesis of amino acids
    LMJF_14_0350
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    LMJF_14_0350
  Metabolism of cofactors and vitamins
   00750 Vitamin B6 metabolism
    LMJF_14_0350
Enzymes [BR:lma01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.3  Acting on phosphates
    4.2.3.1  threonine synthase
     LMJF_14_0350
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
GeneDB: 
UniProt: 
Position
14:104841..106871
Genome map
AA seq 676 aa AA seqDB search
MLILLITGSASKELKAQVRAVLVDEAQLFSASEASEVESSSVFVLCIDAEDSAVMEPLYQ
GYHYRFIWSAQSSMAELVSAVRHLLDSIASAQAHKDKRIGGFFMSTRGASEASNFLDVVR
DGLASDGGLYILKQIPTMPDSQIYYFCKQRNLPYVEAAAMILEQLVDASITPSTLYPLIL
QAYDPSRWSDKDDICPLTPLLMSGETTPTREGEADAVYGLIPSASFNAPERWAANMSVME
LFHGPTAAFKDFALQLFPRCFGAATVTEAKDKYIILAATSGDTGVAAISGFVNAGGHSQV
MVLYPMRGVSPVQQAQMLSFDDGTQVRAYAVDLNFDFCQRTVKELFSNAALRDELAVAEP
TAVRLSSANSINWGRLIPQVVYYFWAYRHHVQHPPAGWVFGDPIDVVVPCGNFGNILSGY
IAKIMGLPLRKLVVASNQNDVLYNFVKTGTYDMRNRTLAVTSSPSIDILKASNVERFLYL
LSNGDTGLVERLMNELDTNGVFTLPDGVRAAMQAVFTAGRCSEEDCAATIKSVFELSGGS
RLLDPHTAVAVFVAQQFREEELLRRDLTNPTSSDTGTDVPPLVIASTAHWAKFPAPVLHS
LRGEGAQLGEPAPSVAAAIQEVRALYAEIKKAAPKQQAHPALSHALDMAEKMAKEVRAVG
ADVAAIEKELRDFSKC
NT seq 2031 nt NT seq  +upstreamnt  +downstreamnt
atgctcattcttctcatcactggcagcgcatcgaaggagctgaaggcgcaggtgcgcgcg
gtgttggtcgatgaagcgcaacttttcagcgcttcggaggcctcagaagtcgagagcagc
agcgtgtttgtgctgtgcatcgatgccgaagactcggcggtcatggagccgctctaccag
ggctatcactaccgctttatctggtctgcacagagctcgatggcggagctggtgtcggcc
gtgcgccacctcctcgactcgatcgcctctgctcaagcgcacaaagacaagcgcatcggc
ggcttcttcatgagcacccgcggcgcctccgaggcgtcgaacttcctggacgttgtccgc
gacggcttggcgagcgacggggggctgtacattctcaagcagattcccacgatgccggac
tcgcagatatactacttctgcaagcagcgcaacctcccctacgtggaggcggcggcgatg
attctggagcagctcgtggacgcgagcatcaccccgtccacgctgtatcccttgattctc
caggcctacgaccctagtcgctggtccgacaaggacgacatatgccccttgacgccgctt
ctgatgagcggggagaccacgccgaccagggaaggcgaagctgacgcagtgtacggcctc
atcccgtccgcctccttcaacgcacctgagcggtgggcggcgaatatgtcggtaatggaa
cttttccatggccccacagccgccttcaaggacttcgccctccagctctttccgcgctgc
tttggagcggcgactgtcacggaggcgaaggacaagtacatcatcctcgccgccacctcc
ggcgacaccggcgttgcggcgatcagcggtttcgtcaacgcgggcgggcactcgcaggtc
atggtgctgtaccccatgcgtggcgtctcgccggtgcagcaggcgcagatgctctccttc
gacgatggtacgcaggtgcgggcctacgcggtggacttgaacttcgacttctgccagcgc
accgtgaaggagttgttctccaacgccgcccttcgcgacgaactcgcggtggcagagccg
acagcagtgcgcctctcatccgccaacagtatcaactggggccgcctcattccccaggtg
gtctactacttctgggcgtaccgccaccacgtgcagcacccgcctgcggggtgggtcttc
ggcgacccgatcgatgtggtcgtgccgtgcggcaactttggcaacatcctgagcggctac
atcgccaagatcatggggctgcccctgcgaaagttggttgtcgcctcaaaccagaacgac
gtgctctacaacttcgtgaagaccggcacgtacgacatgcgcaaccgcactctggcggtg
acgtcgtcgccgtccatcgacatcttgaaggcctccaacgtggagcgtttcctgtacctt
ctgagcaacggcgacacgggtctagtggagcggctgatgaacgagctggacacgaatggt
gtcttcaccttaccagacggcgtgcgggcagcgatgcaggccgtctttaccgctggccgc
tgtagcgaggaggactgcgcggcgaccattaaaagcgtctttgagctatctggcggctcg
cggctgctcgacccacacaccgccgtcgccgtcttcgttgctcagcagttccgcgaggag
gaactcctgaggcgcgacctcaccaacccgacgtcctccgacaccggcaccgatgtgccg
ccgctagtaatcgcgagcacggcgcactgggcaaagttcccagcgccggtgctgcactcg
ctgcgcggcgagggtgctcaactcggtgagccggctccgtccgtcgcggccgcgattcag
gaagtacgcgccctctacgcagagatcaagaaagcggccccgaagcagcaggcgcacccg
gccctgtcgcacgcgctggatatggcggagaagatggcgaaggaggtgcgcgcggtcggc
gccgatgtggcagcgatcgagaaggagctgagggatttttcgaagtgctaa

DBGET integrated database retrieval system