KEGG   Leishmania major: LMJF_14_0350Help
Entry
LMJF_14_0350      CDS       T01014                                 

Definition
(RefSeq) putative threonine synthase
  KO
K01733  threonine synthase [EC:4.2.3.1]
Organism
lma  Leishmania major
Pathway
lma00260  Glycine, serine and threonine metabolism
lma00750  Vitamin B6 metabolism
lma01100  Metabolic pathways
lma01110  Biosynthesis of secondary metabolites
lma01230  Biosynthesis of amino acids
Brite
KEGG Orthology (KO) [BR:lma00001]
 Metabolism
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    LMJF_14_0350
  Metabolism of cofactors and vitamins
   00750 Vitamin B6 metabolism
    LMJF_14_0350
Enzymes [BR:lma01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.3  Acting on phosphates
    4.2.3.1  threonine synthase
     LMJF_14_0350
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Thr_synth_N PALP
Motif
Other DBs
NCBI-GeneID: 5650234
NCBI-ProteinID: XP_001687634
GeneDB: LmjF.14.0350
UniProt: Q4QFV0
Position
14:104841..106871
Genome map
AA seq 676 aa AA seqDB search
MLILLITGSASKELKAQVRAVLVDEAQLFSASEASEVESSSVFVLCIDAEDSAVMEPLYQ
GYHYRFIWSAQSSMAELVSAVRHLLDSIASAQAHKDKRIGGFFMSTRGASEASNFLDVVR
DGLASDGGLYILKQIPTMPDSQIYYFCKQRNLPYVEAAAMILEQLVDASITPSTLYPLIL
QAYDPSRWSDKDDICPLTPLLMSGETTPTREGEADAVYGLIPSASFNAPERWAANMSVME
LFHGPTAAFKDFALQLFPRCFGAATVTEAKDKYIILAATSGDTGVAAISGFVNAGGHSQV
MVLYPMRGVSPVQQAQMLSFDDGTQVRAYAVDLNFDFCQRTVKELFSNAALRDELAVAEP
TAVRLSSANSINWGRLIPQVVYYFWAYRHHVQHPPAGWVFGDPIDVVVPCGNFGNILSGY
IAKIMGLPLRKLVVASNQNDVLYNFVKTGTYDMRNRTLAVTSSPSIDILKASNVERFLYL
LSNGDTGLVERLMNELDTNGVFTLPDGVRAAMQAVFTAGRCSEEDCAATIKSVFELSGGS
RLLDPHTAVAVFVAQQFREEELLRRDLTNPTSSDTGTDVPPLVIASTAHWAKFPAPVLHS
LRGEGAQLGEPAPSVAAAIQEVRALYAEIKKAAPKQQAHPALSHALDMAEKMAKEVRAVG
ADVAAIEKELRDFSKC
NT seq 2031 nt NT seq  +upstreamnt  +downstreamnt
atgctcattcttctcatcactggcagcgcatcgaaggagctgaaggcgcaggtgcgcgcg
gtgttggtcgatgaagcgcaacttttcagcgcttcggaggcctcagaagtcgagagcagc
agcgtgtttgtgctgtgcatcgatgccgaagactcggcggtcatggagccgctctaccag
ggctatcactaccgctttatctggtctgcacagagctcgatggcggagctggtgtcggcc
gtgcgccacctcctcgactcgatcgcctctgctcaagcgcacaaagacaagcgcatcggc
ggcttcttcatgagcacccgcggcgcctccgaggcgtcgaacttcctggacgttgtccgc
gacggcttggcgagcgacggggggctgtacattctcaagcagattcccacgatgccggac
tcgcagatatactacttctgcaagcagcgcaacctcccctacgtggaggcggcggcgatg
attctggagcagctcgtggacgcgagcatcaccccgtccacgctgtatcccttgattctc
caggcctacgaccctagtcgctggtccgacaaggacgacatatgccccttgacgccgctt
ctgatgagcggggagaccacgccgaccagggaaggcgaagctgacgcagtgtacggcctc
atcccgtccgcctccttcaacgcacctgagcggtgggcggcgaatatgtcggtaatggaa
cttttccatggccccacagccgccttcaaggacttcgccctccagctctttccgcgctgc
tttggagcggcgactgtcacggaggcgaaggacaagtacatcatcctcgccgccacctcc
ggcgacaccggcgttgcggcgatcagcggtttcgtcaacgcgggcgggcactcgcaggtc
atggtgctgtaccccatgcgtggcgtctcgccggtgcagcaggcgcagatgctctccttc
gacgatggtacgcaggtgcgggcctacgcggtggacttgaacttcgacttctgccagcgc
accgtgaaggagttgttctccaacgccgcccttcgcgacgaactcgcggtggcagagccg
acagcagtgcgcctctcatccgccaacagtatcaactggggccgcctcattccccaggtg
gtctactacttctgggcgtaccgccaccacgtgcagcacccgcctgcggggtgggtcttc
ggcgacccgatcgatgtggtcgtgccgtgcggcaactttggcaacatcctgagcggctac
atcgccaagatcatggggctgcccctgcgaaagttggttgtcgcctcaaaccagaacgac
gtgctctacaacttcgtgaagaccggcacgtacgacatgcgcaaccgcactctggcggtg
acgtcgtcgccgtccatcgacatcttgaaggcctccaacgtggagcgtttcctgtacctt
ctgagcaacggcgacacgggtctagtggagcggctgatgaacgagctggacacgaatggt
gtcttcaccttaccagacggcgtgcgggcagcgatgcaggccgtctttaccgctggccgc
tgtagcgaggaggactgcgcggcgaccattaaaagcgtctttgagctatctggcggctcg
cggctgctcgacccacacaccgccgtcgccgtcttcgttgctcagcagttccgcgaggag
gaactcctgaggcgcgacctcaccaacccgacgtcctccgacaccggcaccgatgtgccg
ccgctagtaatcgcgagcacggcgcactgggcaaagttcccagcgccggtgctgcactcg
ctgcgcggcgagggtgctcaactcggtgagccggctccgtccgtcgcggccgcgattcag
gaagtacgcgccctctacgcagagatcaagaaagcggccccgaagcagcaggcgcacccg
gccctgtcgcacgcgctggatatggcggagaagatggcgaaggaggtgcgcgcggtcggc
gccgatgtggcagcgatcgagaaggagctgagggatttttcgaagtgctaa

DBGET integrated database retrieval system